KEGG   Ammonifex degensii: Adeg_0107Help
Entry
Adeg_0107         CDS       T00994                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
adg  Ammonifex degensii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Adeg_0107
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Adeg_0107
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Adeg_0107
Enzymes [BR:adg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Adeg_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
97437..98648
Genome map
AA seq 403 aa AA seqDB search
MEKSFLSHLECGRCGKEYEPEKPWQLCTCGGPLLARYDLGKIRSSVRKEDLARRAPNLWR
YREFLPVRKEENIVTLGEGMTPVLPLRRLGAAIGLPHLYLKDEGIIPTGTFKARGAAVGI
SRAKELGVKVLAMPTNGNAGGAWATYAARAGIRAVIVMPKDAPVITRNECAISGAELYLV
DGLISDAGKIVSRAVAERGWYDASTLKEPYRIEGKKTMGLEIVEQFDWQVPDVILYPTGG
GVGIIGIYKALQELQAVGWIGEKMPRLIAVQSSGCAPIVKAWQERKNESEYWENAYTIAF
GINVPKALGDFLVLKAIYETNGCAVAVSDEEILAAQRRLAREEGVFACPEGAATLAAAIR
LREQGWLHPYERVLLLNTGTGLKYPDTVEVSVPLLEKDQDLPN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagctttctgagtcacctggagtgtgggcgctgcggaaaggagtatgagcct
gaaaagccctggcaactctgtacgtgtgggggtcctctgttagcgagatacgatctagga
aagattcggtcatctgtaagaaaagaagatctggcgcgccgtgctcctaatctttggcgt
tatagagagtttttgcctgtaagaaaggaagagaatattgttactctgggagagggaatg
acacctgttttgcccttgcgccggttgggagccgcaataggtttgccacacctatactta
aaagacgaaggaatcattcctaccggcaccttcaaagctcgtggagcggcagttggcatt
tctcgagccaaggagttaggcgttaaagttcttgctatgcctaccaatggcaatgcaggt
ggagcgtgggctacttatgctgctcgggctgggatcagagctgtaattgttatgcccaag
gatgctccagtcataacgcgtaatgaatgcgctattagcggtgctgaactttatcttgtg
gacggtttaattagtgatgctggtaagattgttagtcgtgcagtagccgaaagaggttgg
tacgacgcttcaacacttaaggaaccttatcggatcgaaggtaagaaaaccatggggttg
gagattgttgaacagtttgactggcaagttcctgacgtgattctctatcccactggtgga
ggggtaggtattattggtatctataaagctttgcaggagttacaggctgtaggttggatt
ggggaaaagatgcctcgtttgatagcagtccagtccagtggttgtgctcctattgtaaag
gcttggcaagaacgcaagaatgaatccgaatattgggaaaatgcctatactattgctttt
ggtattaatgttcccaaagccctaggtgattttcttgtccttaaggcaatttacgagact
aacggttgcgctgtggcagtgagtgatgaggagattttggctgctcagcgaaggttagcg
agggaggaaggagtttttgcgtgtcctgagggagctgccactctcgctgctgcgatcagg
ctgagggaacaagggtggctgcatccttatgagagagttctgttattgaatacagggacg
ggcctaaagtatcctgatactgtggaggtcagcgtgcctttgctggagaaagaccaagac
cttcccaattag

  All links  
No link information was found.   
DBGET integrated database retrieval system