KEGG   Ammonifex degensii: Adeg_0186Help
Entry
Adeg_0186         CDS       T00994                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
adg  Ammonifex degensii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Adeg_0186
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Adeg_0186
Enzymes [BR:adg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Adeg_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
182205..183326
Genome map
AA seq 373 aa AA seqDB search
MRREEFKHCRRLVVKVGTSSITLPSGELNLEQIAKLVDELAAVHREGKEVLLVSSGAIGA
GMGRLGLRSRPRTIPEKQACAAVGQGLLMQIYERFFSSHGITVGQVLLTRDDFAHRRRFL
NARNTLLTLLEYRVVPIINENDTVAVEEIRLGDNDTLSALVASLINAELLLILSDVDGLY
TGDPRRDPQARLISEVKELTPEIWALAGGPGSQVGSGGMLTKLEAARIAGRSGCTLVIAR
ASLPGVIRRVLAGEEIGTVFFPREKLREKRRWLLFGAQVKGKIYVDAGAAKALREGGKSL
LPSGIVGVEGNFEAGHAVSIVDPEGKEIARGLVNYSAAEVEQIKGCKTCEIEAVLGSRLY
DEVVHRDNLVLQE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgggaggagtttaagcactgtcgccgcctggtggtcaaggtagggacgagttct
attactttgccttccggggagctcaatttggagcaaatagccaagctggtggacgaactg
gcggctgttcaccgggaggggaaagaagttctgcttgtctcctcgggagccatcggagcg
ggcatggggaggctggggcttaggagccggccccgcaccataccggaaaagcaggcctgc
gccgcagtggggcaagggctgctcatgcagatctacgagcgcttcttctcttcccacggc
atcaccgtggggcaagtgttgctcacgcgggacgactttgcccaccgccgccgtttcctg
aacgcccgcaacacgctccttaccctgctggagtaccgggtggttcccatcatcaacgaa
aacgacacggtggcggtggaggagattcgcctgggggacaacgacaccctttctgccctg
gtggccagcctgataaacgccgagctcctactcatcctctctgatgtggatgggctttac
accggagatccccgccgcgacccgcaggcccggctgatttccgaggttaaagaactcacg
ccggagatatgggctttggccggcggacccggttcgcaggtgggtagcgggggaatgctt
accaaactggaagcggcccgcattgccggccgctccggctgcaccctagtgatcgcccgg
gcttccctgccgggggtgataaggcgcgtcctggccggagaggagatcgggaccgtcttc
ttccctcgcgagaagctgcgcgagaagaggcgctggctgctcttcggcgcccaggtaaag
ggaaaaatctacgtggatgcgggagcggccaaggctttgcgggaaggagggaagagcctt
ctcccctccggcatcgtaggagtagagggaaacttcgaggcggggcacgccgttagcata
gtggaccccgaagggaaggagatcgcgcggggcctggtgaactactcagcagcggaagta
gagcagatcaaagggtgcaagacttgcgagatcgaggccgtgctcggttcccgcctttat
gatgaagtggtgcaccgggacaacctggtattgcaggagtaa

DBGET integrated database retrieval system