KEGG   Ammonifex degensii: Adeg_0193Help
Entry
Adeg_0193         CDS       T00994                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
adg  Ammonifex degensii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Adeg_0193
  Amino acid metabolism
   00300 Lysine biosynthesis
    Adeg_0193
Enzymes [BR:adg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Adeg_0193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187155..188420
Genome map
AA seq 421 aa AA seqDB search
MIDPNVLQEVERLRGEMVETLVELIRIPALSPDNGGEGELRKAEKLEEIIRRWPFDRIER
YDAPDPRALNGIRPNLLAYYYGERGKESPRLWILTHLDVVPPGDLEKWTETSPFNPLVKE
GKVYGRGSEDNGQSLVASLYAVKALMNLGLRPKRTFVLAFVSDEETGNRYGIEWLIKNHP
ELFHREDLVLVPDGGDREGIFIEIAEKSLLWLKIRVEGKQVHGSTPHKGFNAFRVALDYA
SSLDRLLHEKYADKDELFELPVSSFEPTMGKSLSDAPNIIPGEVEIVFDCRVLPRYRLDD
ILREAEELARQIEARHRKEIGEKVLPRIKLEVLQRVESPATLADSQIVKLLRRAIKELRG
KEAKVGGIGGGTFAAYFRRLGIPAAVWGTFDELAHQPNEYARIDNLVEDAKVMAYLGLSA
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacccgaatgtgttgcaggaagtagagcgcctgcgcggcgagatggtggagacc
ctggtggagctcattaggatacccgctttaagtccggataacgggggcgagggggagctc
cgcaaggcggagaagctggaagaaatcatccgccgctggcccttcgaccggatagagcgc
tatgacgccccggatcccagggctttaaacggtatacgccccaacctcctggcctactac
tacggcgagagaggaaaagagagcccccgtttgtggatcctcacccacctggatgtagtt
cccccgggcgacctggaaaagtggacagaaacctctccctttaaccctttggtcaaggaa
ggtaaagtttacggccggggaagcgaagataacgggcagagcctggtagcctccctttac
gcggtgaaggcgctcatgaacctgggtctcaggcccaagcggaccttcgtcttagccttc
gtcagcgacgaggagacgggtaacaggtacggcattgagtggctcataaagaaccacccg
gagcttttccaccgggaggatctggtcctagtgcccgacgggggagaccgggaaggaatt
ttcatcgagatcgccgagaaaagccttctctggctgaaaatcagggtagagggaaagcag
gtgcacggaagcaccccccacaaggggtttaacgcctttcgggtagccctggactacgcc
tcctctctcgaccggctgcttcatgagaagtatgccgataaagacgaactcttcgagctc
ccggtgagttccttcgagcccaccatggggaaaagcttgagcgatgcccccaacataatc
cccggcgaagtggaaatcgtcttcgattgccgtgtacttccccgctaccggctggacgac
attctgagagaggccgaggagctggcgaggcagatcgaagccaggcaccggaaggaaata
ggggaaaaggttcttccccggataaagcttgaggtcttgcagcgggtggagtcccctgcc
actttagccgacagccagatagtaaagctcctccgccgagccataaaggaactcaggggc
aaagaggccaaggtaggaggcatcgggggaggaacctttgccgcctatttccggaggctc
ggcatcccggcggcggtctggggcacttttgatgaactggcccatcagcccaacgagtac
gcccggatcgacaacttggtggaagacgccaaggtcatggcctacctgggcctttccgca
gattag

DBGET integrated database retrieval system