KEGG   Ammonifex degensii: Adeg_0259Help
Entry
Adeg_0259         CDS       T00994                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
adg  Ammonifex degensii
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Adeg_0259
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Adeg_0259
Enzymes [BR:adg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Adeg_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
259303..259764
Genome map
AA seq 153 aa AA seqDB search
MQLIHGVQVKKLRLIPDDRGFLMECLRSDWPEFTKFGQAYVTACYPGVIKAWHYHKVQWD
HFVCIYGMAKVALYDPREDSPTRGMVNVFHIGLLNPCLIKIPPRVYHGFTSEGGQLALIL
NIPTELYNYEEPDEYRVPYNDPSIPFSWEVKHG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgcaactcattcacggcgtgcaggtgaaaaagctcaggctcattcctgatgaccgggga
ttcttgatggagtgcctgcgttccgactggccggagtttacgaagttcggccaggcctac
gttaccgcctgctatcccggagtgataaaagcctggcactaccacaaggtgcagtgggac
cacttcgtctgcatctacggcatggccaaggtagcgctttacgacccgcgcgaggacagc
cccaccaggggcatggtcaacgtctttcacatcgggcttttaaacccctgcctcataaag
ataccgccgcgggtctaccacggcttcaccagcgagggggggcagctcgccctcatcctc
aacatccccaccgagctttacaactacgaggagccggacgagtaccgtgtcccctacaac
gacccttccatccccttctcctgggaagtaaagcacgggtag

DBGET integrated database retrieval system