KEGG   Ammonifex degensii: Adeg_0313Help
Entry
Adeg_0313         CDS       T00994                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
adg  Ammonifex degensii
Pathway
adg00340  Histidine metabolism
adg01100  Metabolic pathways
adg01110  Biosynthesis of secondary metabolites
adg01230  Biosynthesis of amino acids
Module
adg_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Adeg_0313
Enzymes [BR:adg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Adeg_0313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF1737
Motif
Other DBs
NCBI-ProteinID: ACX51476
UniProt: C9RB49
Position
310399..311676
Genome map
AA seq 425 aa AA seqDB search
MLKIITYDDPRLPQVLDRRFSFPSEAADQVASILQEVKEKGDEAVLSFTARFDRVNLRPE
ELEVTAAEIDRAYEEVSPAYLTAVKCAVTRIFNFHAKHVPKSWHEVKPDGSVWGELVRPL
ERVGIYVPGGRARYPSSVLMNAVPARVAGVKEIVMATPPGPEGRVDPHVLVAAREAGVSR
IFRVGGAQAVAALAYGTERIPRVDKIVGPGNIYVTLAKRMVFGQVGIDLLAGPSEVAVVA
DETAPAAWVAADLLAQAEHDPQARVLLVTTSRELAEEVNRRLQEEWRSLGSPSGAREALL
ASWAVLVPDLSAALDCVNRFAPEHLELLVADPAPLVEQVKHAGAIFLGPYSPVPMGDYIA
GPNHVLPTGGTARFASPLGVADFLKRTSVLKLSPAAFQELAPHAAALAEVEGLVAHARAI
KVRGV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaagatcataacctacgatgacccccgcttgcctcaagtgctggaccgccgcttc
tcctttccttccgaggctgctgatcaggtagctagcatcttgcaggaggtgaaggagaag
ggggacgaggcggtcttatccttcaccgcccgcttcgatcgggtgaacctgcgccctgag
gagctggaggttacggcggcggagatcgaccgggcttacgaggaagtttccccagcgtat
cttacggccgtcaagtgcgcggtcacccgcatcttcaacttccacgccaagcatgtgccc
aagagctggcacgaagtgaagcccgacggctcggtctggggggagttggtgcggccgctg
gagcgggtggggatctacgtccccggcggcagggcgcgctacccctcctcggtgctgatg
aacgccgtgccggcgcgggtggcgggagtgaaggagatcgtgatggccactcctcccggc
ccggaggggagggtcgatccgcacgtcctagtggccgcgcgcgaggccggggtgagccgc
atcttccgggtgggcggggcgcaggccgtggcggccctggcctacgggacggagcgcatc
ccccgggtggacaagatagtggggccgggcaacatctacgtcaccttggccaagcggatg
gtcttcggccaggtggggatcgaccttttggccggtcccagcgaggtggcggtggtggct
gacgagactgctcctgcggcctgggtggcggccgacctcctggcccaggcggagcacgat
ccccaagcccgcgttctcctggtcaccacctcccgcgagctggccgaggaggtgaaccgg
aggcttcaggaagaatggcgctctttaggctcccccagcggggcgagggaggcgcttttg
gccagctgggcggtgctggtgcccgatttatcggcagcccttgactgcgtcaaccgcttt
gctcccgagcacctggagctcctggtggccgacccggctcccctggtagagcaggtgaag
cacgccggagccatcttcctgggaccctactcgcccgtccccatgggggactacatcgcc
ggccccaaccacgtcctgcccacgggagggacggcccgcttcgcttcgcctctaggggtg
gccgactttctcaaacgcaccagcgtgctcaagctctctccggcggctttccaggaactg
gcgccgcacgcggcggctttagccgaggtggagggactggtggcccacgcgcgggcgatc
aaggtgcggggggtgtag

DBGET integrated database retrieval system