KEGG   Ammonifex degensii: Adeg_0439Help
Entry
Adeg_0439         CDS       T00994                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
adg  Ammonifex degensii
Pathway
adg00010  Glycolysis / Gluconeogenesis
adg00030  Pentose phosphate pathway
adg00051  Fructose and mannose metabolism
adg00052  Galactose metabolism
adg00680  Methane metabolism
adg01100  Metabolic pathways
adg01110  Biosynthesis of secondary metabolites
adg01120  Microbial metabolism in diverse environments
adg01130  Biosynthesis of antibiotics
adg01200  Carbon metabolism
adg01230  Biosynthesis of amino acids
adg03018  RNA degradation
Module
adg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeg_0439
   00030 Pentose phosphate pathway
    Adeg_0439
   00051 Fructose and mannose metabolism
    Adeg_0439
   00052 Galactose metabolism
    Adeg_0439
  Energy metabolism
   00680 Methane metabolism
    Adeg_0439
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Adeg_0439
Enzymes [BR:adg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Adeg_0439
Protein phosphatases and associated proteins [BR:adg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Adeg_0439
Messenger RNA biogenesis [BR:adg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Adeg_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK PucR NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACX51591
UniProt: C9RBG4
Position
449594..450556
Genome map
AA seq 320 aa AA seqDB search
MRRIGVLTSGGDAPGMNAAIRAVVRKGIYEGCEVWGIKRGFAGLIEGDIVPLELGSVADT
IHRGGTILLTARSQEFMTEEGRREAFASLHRAGIEGLIGIGGEGTFKGLLTFHRETGFPV
IGVPATIDNDIGGTDYTIGFDTAVNNVVDAINKIRDTATSHERTFVVEVMGRNTGFIALT
AGLAGGAESILIPEFPFDIETVCQRLMRGMRRGKRHSIIVVAEGVGSAPAIAQEIKQRTG
LETKAIILGHIQRGGTPTVFDRVLASIMGARAVELLLAGERRAAVCLVGGEIKHCDLEEA
LRTTKKIDEAAYKLAEILAI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcgtataggagtactcaccagcggtggcgatgctccggggatgaacgccgccata
agggcagtagtgcgcaaagggatttatgaagggtgcgaggtctgggggatcaagcggggt
tttgccggtcttatcgagggagatatcgttcctttggagctgggatcggtggccgacacc
atccaccgcggcggaaccatcctgcttacggcccgctcgcaagagttcatgacggaggag
gggcgtcgggaggcttttgcctcccttcatcgtgccggtattgaggggctaataggcata
ggcggggagggaacttttaagggactcctcaccttccaccgggagacggggttccccgtc
atcggcgtgccggccaccatcgataacgacatcgggggcaccgattacaccataggtttc
gacacggcggtaaacaacgtggtggacgctataaataagataagggatacggccacctcc
cacgagcgcacttttgtggtagaggttatggggcgcaacacgggctttatcgccctaacg
gccgggctggcaggaggtgccgagtccatcttgatccccgagttccccttcgatatagag
acggtctgccagcgcctcatgcggggcatgaggcgtggcaagcggcacagcatcatcgtg
gtggcagaaggggtgggcagtgcccccgccattgcgcaggagatcaagcagcgcacgggc
ctggaaaccaaggctataatcctggggcacattcagcgcggcggcacgcccaccgtgttc
gaccgggtgctggccagcattatgggggcaagggcggtggagctcctgctggctggggaa
aggagggcagccgtgtgtctggtgggaggggagatcaagcactgcgacctggaggaagcc
cttaggaccaccaagaagatcgacgaggccgcctataaactggccgaaatcttggctata
taa

DBGET integrated database retrieval system