KEGG   Ammonifex degensii: Adeg_0439Help
Entry
Adeg_0439         CDS       T00994                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
adg  Ammonifex degensii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Adeg_0439
   01230 Biosynthesis of amino acids
    Adeg_0439
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeg_0439
   00030 Pentose phosphate pathway
    Adeg_0439
   00051 Fructose and mannose metabolism
    Adeg_0439
   00052 Galactose metabolism
    Adeg_0439
  Energy metabolism
   00680 Methane metabolism
    Adeg_0439
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Adeg_0439
Enzymes [BR:adg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Adeg_0439
Protein phosphatases and associated proteins [BR:adg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Adeg_0439
Messenger RNA biogenesis [BR:adg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Adeg_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
449594..450556
Genome map
AA seq 320 aa AA seqDB search
MRRIGVLTSGGDAPGMNAAIRAVVRKGIYEGCEVWGIKRGFAGLIEGDIVPLELGSVADT
IHRGGTILLTARSQEFMTEEGRREAFASLHRAGIEGLIGIGGEGTFKGLLTFHRETGFPV
IGVPATIDNDIGGTDYTIGFDTAVNNVVDAINKIRDTATSHERTFVVEVMGRNTGFIALT
AGLAGGAESILIPEFPFDIETVCQRLMRGMRRGKRHSIIVVAEGVGSAPAIAQEIKQRTG
LETKAIILGHIQRGGTPTVFDRVLASIMGARAVELLLAGERRAAVCLVGGEIKHCDLEEA
LRTTKKIDEAAYKLAEILAI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcgtataggagtactcaccagcggtggcgatgctccggggatgaacgccgccata
agggcagtagtgcgcaaagggatttatgaagggtgcgaggtctgggggatcaagcggggt
tttgccggtcttatcgagggagatatcgttcctttggagctgggatcggtggccgacacc
atccaccgcggcggaaccatcctgcttacggcccgctcgcaagagttcatgacggaggag
gggcgtcgggaggcttttgcctcccttcatcgtgccggtattgaggggctaataggcata
ggcggggagggaacttttaagggactcctcaccttccaccgggagacggggttccccgtc
atcggcgtgccggccaccatcgataacgacatcgggggcaccgattacaccataggtttc
gacacggcggtaaacaacgtggtggacgctataaataagataagggatacggccacctcc
cacgagcgcacttttgtggtagaggttatggggcgcaacacgggctttatcgccctaacg
gccgggctggcaggaggtgccgagtccatcttgatccccgagttccccttcgatatagag
acggtctgccagcgcctcatgcggggcatgaggcgtggcaagcggcacagcatcatcgtg
gtggcagaaggggtgggcagtgcccccgccattgcgcaggagatcaagcagcgcacgggc
ctggaaaccaaggctataatcctggggcacattcagcgcggcggcacgcccaccgtgttc
gaccgggtgctggccagcattatgggggcaagggcggtggagctcctgctggctggggaa
aggagggcagccgtgtgtctggtgggaggggagatcaagcactgcgacctggaggaagcc
cttaggaccaccaagaagatcgacgaggccgcctataaactggccgaaatcttggctata
taa

DBGET integrated database retrieval system