KEGG   Ammonifex degensii: Adeg_0496Help
Entry
Adeg_0496         CDS       T00994                                 

Definition
phosphoglucosamine mutase (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
adg  Ammonifex degensii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeg_0496
   00030 Pentose phosphate pathway
    Adeg_0496
   00051 Fructose and mannose metabolism
    Adeg_0496
   00052 Galactose metabolism
    Adeg_0496
   00500 Starch and sucrose metabolism
    Adeg_0496
   00520 Amino sugar and nucleotide sugar metabolism
    Adeg_0496
  Nucleotide metabolism
   00230 Purine metabolism
    Adeg_0496
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Adeg_0496
Enzymes [BR:adg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Adeg_0496
    5.4.2.8  phosphomannomutase
     Adeg_0496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
515555..516997
Genome map
AA seq 480 aa AA seqDB search
MGKVFGTFGVRGVVGRELDPTLVQRIGAAFGTFLRDKRRGRPLVVVGRDTRLSGEALKRA
LVSGLLGVGAEVLDVGVVPTPVVQFACRHFGVDGGAVITASHNPPEYNGIKLLEPDGLGL
GKEAEEELEDLLLNGRFAYAGWNETGRVTRQDILRPYLEGVKKRLDVEAIARRRPLVVAD
TANGAGSLVLPYLLSELGCRVISVNGHPDGRFPGRNPEPNEENLRSFLTIVRSVGADFGV
AQDGDADRSVFADEEGRFVQGDKTFALVAGALLEERGGGLVVTTVATSDVVDEVARVRGG
RVLRTKVGDAVVSRALKEHGGLVGGEENGGVIFPDFVLGRDGAMTAAKVLEVFCRQGLRF
SELIASLPRFYQLKTKERVEGDRKGIVALVGELARNEGYRVDSTDGVKILFEDGWVLVRA
SGTEPIVRIFAEAKEETKVRTYLEFGRTLLSRALKGQLPAGMGIVKDGQPGLGLVETGRA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggtcttcggcactttcggcgtacgcggcgtggtgggcagagaactcgatcct
actctggtgcagcggatcggggcggccttcggcactttcctccgggataagcgacgggga
agacccctggtagtagtggggcgggacaccaggctgagcggtgaggcgctgaaaagagct
ctggtgagtggccttctgggagtaggggcagaagttctggacgtgggtgtggttcccacc
ccagtggtccagtttgcctgccgccacttcggggtcgacggcggggcggttatcactgcc
tcccacaacccgccggagtacaacgggatcaagctcctggagcccgacggtctggggttg
ggcaaggaggcggaggaggagctggaagacctgcttctgaacgggcgcttcgcttacgct
ggctggaacgaaacggggcgcgtcacccggcaggacattctgcgcccctatcttgaggga
gtgaaaaagcggctggatgtagaagccatagcccgtcggcgtcccctggtggtggctgac
acggccaacggcgccggcagcctggtgctcccttaccttttgagtgagcttggctgccgg
gtgataagcgtcaacggccacccggacggccgcttccccgggagaaaccccgagcccaat
gaggaaaacctccgctctttcctgaccatcgtgcggtcggtgggggcggacttcggggtg
gctcaggacggcgatgccgaccgctccgtcttcgccgacgaggaagggcgcttcgtccag
ggagacaaaaccttcgccctggtggccggcgctctgctggaggagcgcggcgggggtttg
gtggtcaccacggtggctacctcagatgtggtggacgaggtagcgcgggtacggggcggc
agggttctgcggaccaaggtgggggatgcggtggtctcgcgggccttaaaggagcacggg
ggcctggtcggcggggaagaaaacggcggggtgatctttcccgacttcgtgctgggacgc
gacggggctatgaccgcggccaaggtgctggaggtcttctgccgtcagggcctgcgcttc
agcgagctcatagcctccctgccccgcttttaccagcttaagaccaaggagcgggtagaa
ggggaccggaagggcatcgtggccctggtgggagagttagcccgcaatgagggttaccgt
gtcgattcgaccgacggggttaaaatactctttgaagacggttgggtgctggtgcgggcc
agcggcaccgagcccatagtccgtatattcgccgaggccaaggaagaaaccaaagtacgc
acctacctggagttcggccgcaccctgctgagccgtgccttaaaggggcagcttccggcc
gggatggggatcgtaaaggatggccaaccgggcttgggactggttgaaacaggccgagcg
tga

DBGET integrated database retrieval system