KEGG   Ammonifex degensii: Adeg_0556Help
Entry
Adeg_0556         CDS       T00994                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
adg  Ammonifex degensii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:adg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
576545..577585
Genome map
AA seq 346 aa AA seqDB search
MAEERKRRVYPFAALVGQEEMKLALILNAINPKLGGVLIRGEKGTAKSTAVRGLAALLPE
LKVVADCPFGCDPDDVATMCQDCRERYQRGEELPVATRRMRVVDLPVSATEDRVVGTLDL
EHAIKKGEKRFEPGVLAEANRGILYVDEVNLLDDHVVDVLLDAAAMGVNTVEREGVSFSH
PANFILVGTMNPEEGELRPQLLDRFGLCVNVVGVRDPAARVEIVKRRAAFEEDPEGFCRQ
WEPAQEEIRRRILAAREILPAVKISDEMLLRIATLAVEMGVDGHRADIVLMKAAKTHAAY
EGRTEVREEDILATAPLVFRHRLRRRPFEEVEEAERLAAALRRAWS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttggcggaagaaagaaaaagaagggtctatcctttcgccgcgttggtgggccaggaggag
atgaagctggccctcatcctcaacgccattaaccccaagctcgggggcgtgctcataagg
ggggaaaaggggacggccaagtccacagccgtgcggggactggcggcccttctgccggag
ctcaaggtggtggctgactgtcccttcggttgcgatccggacgacgtggccaccatgtgc
caggactgccgggagagataccagcggggggaggagttgccggtggccacccggcgcatg
cgggtggtcgatctgccggtttcggccaccgaggaccgggtagtgggtacgctcgacctg
gagcacgccatcaagaagggggagaagcgcttcgagcccggcgttctggccgaggccaac
cgggggatactctacgtggatgaagtaaacctcctggacgaccacgtggtggacgtcctg
ctggacgcggccgccatgggggtcaacacggtggagcgggaaggggtctctttctcccac
ccggccaatttcatcctggtgggtactatgaacccagaagaaggggagttgagaccccag
ctgctggaccgctttgggctgtgcgtaaacgtggtgggggttagagacccggcggcgcgg
gtggagatagtgaagcgccgggccgcctttgaagaagatcccgaggggttctgcaggcag
tgggagccggcgcaggaggagatccgacggcgcatcctggcggcgcgggagatcctgccc
gcggttaagataagcgacgagatgctcctgcgcatcgccaccctggcggtggagatgggg
gtagacgggcaccgcgccgacatcgtgctcatgaaggcggccaagacccacgcggcctat
gaggggcgcaccgaggtaagggaggaggacatcctggccacggcgcctctggtcttccgg
caccgtctgcggcgccgtccctttgaggaggtggaggaggccgagaggctggcggcagcc
ctgcgccgggcctggagttaa

DBGET integrated database retrieval system