KEGG   Ammonifex degensii: Adeg_0568Help
Entry
Adeg_0568         CDS       T00994                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
adg  Ammonifex degensii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Adeg_0568
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Adeg_0568
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Adeg_0568
Enzymes [BR:adg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Adeg_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(590650..592152)
Genome map
AA seq 500 aa AA seqDB search
MLYESTRGQAPPVKAAETILQGLAPDGGLYVPEFFPRLRFSSIEELSRHSYPEQAVRLIS
LFLTDFSPAEVSSAVLAAYNPLKFDTEEIVPLKVLAPDVGILELWHGPTHAFKDLALTLL
PHLMTRATQKLGLEKEIVILVATSGDTGKAALESFRDVPKTRIIVFFPSEGVSEIQKRQM
ITQEGENTFVVAVEGNFDDAQSGVKQLFGDPELRRKMESAGMTFSSANSINWGRLLPQVV
YYFSAYARLLRDKLIRHGEEINFVVPTGNFGNILAGFLAREMGLPVRRLILAANANNVLT
DFINTGIYDRRRPFHRTISPSMDILISSNLERLLYLVTDRNAEKVRQWMTSLARTGVYQI
DQATHERIKQVFWSSWASDDETLAAIKDAYTRYGYLLDPHTGVAWHVFNRYREETGDSTK
TVILSTASPFKFARDVIRALAPEKLAGKEELSLLYLLAELTGWPIPRGLQGLESKPIRHT
RKATREKMRGVVEEILGLTP
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtgctttacgagagtacccgtgggcaggcgccgccggtcaaagcagccgaaaccatcctg
caggggctagctcccgacggtgggctttacgtgcccgaattctttccccggctacgcttc
agctccattgaggaactaagccgtcactcctatcccgagcaggcggtgcgcctcatctca
ctcttcctcaccgatttttcccctgcagaagtatcttctgccgtcttggctgcctacaat
cccttaaaatttgacaccgaagaaatagtccccctcaaagtgctggcccccgatgtcggc
atcttagagctttggcacggccccacccacgccttcaaggacctggccctaaccttactg
ccccatctcatgacccgggcgacgcaaaagctggggctggagaaagaaatagtcatcctg
gtagccacctcgggagacacaggcaaggccgctctggaaagtttccgggatgttcccaaa
accaggataatcgtcttctttcccagcgaaggggtaagcgagattcagaaaagacagatg
ataacccaggaaggagaaaacacctttgtagtagccgtggaggggaactttgacgacgcc
cagagcggggtcaagcagctcttcggtgacccggagctccgccggaagatggaaagcgcc
gggatgaccttctcctcggccaactccatcaactggggaaggctacttccccaggtagtc
tactacttcagcgcttatgcccgccttctgcgggacaagctcatccgccacggtgaggag
atcaacttcgtagttcctactggcaacttcggcaatattctggctggtttcttagcccgg
gaaatggggcttccggtacgaagactcatcttggccgccaacgccaacaacgtgctcacc
gactttattaataccgggatctatgaccgccgccgtccctttcaccgcaccatctccccc
tccatggacatcctgatctccagcaacctggaaaggcttctctacctagtcaccgaccgg
aacgcggagaaggtgcggcagtggatgacctcactcgctagaacgggcgtttaccagatc
gaccaggccacccacgagcggataaagcaggtcttctggtcctcctgggcaagcgatgat
gagaccctggcggccataaaggacgcctatactcggtacggctacctcctcgatccgcac
accggcgtggcctggcatgtctttaaccgctaccgggaagagacgggagatagtaccaag
accgtgatcctctccaccgccagccccttcaagttcgcccgggacgtcatccgcgccctg
gcccccgaaaagctggccggtaaagaagagctttccctcctttatcttctggccgagctt
accggttggcccataccccggggactgcaagggctggagagtaaaccaatccggcacaca
cgtaaagcgacccgggaaaagatgcggggagtggtggaagaaattctgggcctcacacct
taa

DBGET integrated database retrieval system