KEGG   Ammonifex degensii: Adeg_0665Help
Entry
Adeg_0665         CDS       T00994                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
adg  Ammonifex degensii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Adeg_0665
   01230 Biosynthesis of amino acids
    Adeg_0665
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeg_0665
   00030 Pentose phosphate pathway
    Adeg_0665
   00051 Fructose and mannose metabolism
    Adeg_0665
  Energy metabolism
   00680 Methane metabolism
    Adeg_0665
Enzymes [BR:adg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Adeg_0665
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Adeg_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(689528..690664)
Genome map
AA seq 378 aa AA seqDB search
MGKKITVTVIKADVGGLVGHTSVHPELLEKARGVLSGSPLLIDFYVTSVGDDINLIMTHE
LGRNNGEIHKLAWDTFVACTEVAKKLKLYGAGQDLLADAFSGNIKGLGPGIAEMEVEERE
SEPIVIFMADKTEPGAWNLPLYKIFADPFNTIGLVIDPKMHCGFTFEVRDLIENKKIMFN
APEDIYDMLVFIGAPGRYAIKRIFHRETGQIAAVSSVQRLNLIAGRYIGKDDPVCIVRCQ
SGYPAVGEVLEPFAHPHLVSGWMRGSHSGPLMPVSLKDARPSRFDGPPRVVALGFQLADG
KLIGPQDLFDDPAFDRAREMANIIADYMRRLGPFEPHRLHLDEMEYTTMPMVMQKLKDRF
IDLRLAKAQKAQKEKGGA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtggggaaaaagatcacggtaaccgtcatcaaagctgacgtaggcggcctcgtaggtcac
actagcgtccacccggaattactggaaaaggcaaggggagtgctttcaggaagccccctg
ctgatagacttctacgtgaccagcgtgggtgacgacataaacttaatcatgacccacgag
ctggggcgtaacaacggagagatccacaagctggcctgggataccttcgtggcctgcacg
gaagtggccaagaagctcaagctttacggggctgggcaggatctcctggccgatgccttc
tccggtaacatcaaggggctggggcctggcattgccgaaatggaagtggaagaacgagaa
agtgaacccatagtcatcttcatggccgacaagaccgaacccggtgcgtggaacctgcct
ctttacaagatttttgccgatcccttcaacaccatcggcttggtcatcgatcctaagatg
cactgcggcttcaccttcgaagtgagagaccttatcgagaacaaaaagataatgttcaac
gctccggaagatatctacgacatgctggtcttcataggcgcgcccggccgctacgctatc
aagcgtatcttccaccgggagacaggacagatcgcggccgtttccagcgtgcagcgcctc
aatctcatcgccggacgttacatcggcaaggacgacccggtttgcatcgtccgctgccag
agcggctatccagctgtgggagaggtgctggagccttttgcccacccgcacctggtgtcc
ggctggatgcggggttcgcacagtggtcctctgatgccggtctccttaaaagacgcccgt
ccctcccgcttcgacgggccgccgcgggtggtagccctgggcttccagctggccgacggc
aaactcatcgggccccaggatctgttcgacgatccggccttcgaccgggccagggaaatg
gccaacatcatcgctgactacatgcggcggctgggtcccttcgagcctcaccgcctacat
ctggacgagatggagtacaccaccatgcccatggtcatgcagaagttaaaggatcgcttc
atcgacctgaggctggccaaggctcagaaagcgcaaaaggaaaagggcggggcataa

DBGET integrated database retrieval system