KEGG   Ammonifex degensii: Adeg_0840Help
Entry
Adeg_0840         CDS       T00994                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
adg  Ammonifex degensii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Adeg_0840
Enzymes [BR:adg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Adeg_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
854367..854975
Genome map
AA seq 202 aa AA seqDB search
MKTGLLLVISGPSGVGKGTVCRALLEKDPSIYLSVSVTTRPPRVGEKDGQDYFFVSEERF
LEMVARGELLEWARVYSFYYGTPKAPVFEALAAGRDVLLEIDVQGGFKVRENYKDCVLIF
LLPPSWEELEARLVRRGTEDAQARQFRLNWAKQELSLYHRYDYAVVNERVEDTVAAIEAI
RVAERCRSHRQQFPWLKTLLEG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccggccttttactggtcatctccggaccttcgggagtgggtaagggcaccgtc
tgccgggctctcctagagaaagacccttctatttatctatccgtttcggtaaccacccgc
ccgccgcgggtaggggagaaggacggccaagattattttttcgtgtctgaagaacgcttt
ctggagatggtggcccggggtgagcttctggagtgggcccgcgtctattctttctactac
ggcactcccaaagctccggtttttgaggccttggccgccggccgcgatgtgttgctggag
atcgacgtccagggcgggtttaaggttcgggaaaactataaagactgtgtcctcatcttt
ctcttacccccttcctgggaggaactggaggccaggctggtgcgccggggtacggaagat
gcgcaggcacgccagtttcgtttgaactgggccaagcaagagctcagtctctatcaccgc
tacgattacgcagtggtaaacgagcgggtcgaagatacggtggccgcgatcgaggccatc
cgggtagcggaaaggtgtcgttcccaccgccaacagttcccctggcttaaaacacttctc
gaaggataa

DBGET integrated database retrieval system