KEGG   Ammonifex degensii: Adeg_0902Help
Entry
Adeg_0902         CDS       T00994                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
adg  Ammonifex degensii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Adeg_0902
Enzymes [BR:adg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Adeg_0902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916526..917455
Genome map
AA seq 309 aa AA seqDB search
MVLGCGALNVDYLFATELLVTDGETFCHPVTRQPGGSAANTIYGLSKLSFPCAFVGAVGD
DPDGRLALEALAEVGVNTRAVKVREGRGTGKVFAFVDPKGRRALYVSPDANLTLTLDDML
EALTPEVRWVHCSSFAGDPPFEAQREFVSRLPEEVGFSFAPGALYARRGLKELEPMLYRC
TLLFLTQAELETMTGEGVLLNGARLLLNLGVRVVVVTLGGEGSVVVTPGGCDYQTALAQR
VVDTTGAGDGFAAGMLYGYLKGWPLELAHRLASIVAAFVVENWGARAGMPSLEEAKKRYE
ATFGLPFPE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtggttttagggtgtggcgcgcttaacgtagactatcttttcgctaccgagcttttggta
accgacggggagaccttctgccaccccgtaacccgtcagccgggcggttcggccgccaat
accatctacggcttgagcaagctctctttcccctgcgcctttgtgggagcggtgggggac
gatcccgacgggcgcctagccctggaggccctggcggaggtcggtgtgaacacgcgggcc
gtgaaggtgcgggaaggaaggggaacgggcaaggttttcgccttcgtcgatcccaaggga
aggagggcgctttacgtctctcccgacgctaacctcacgttgaccctggacgacatgctg
gaggctttaaccccggaagtgcgttgggtgcattgctcctcctttgccggtgaccctccc
tttgaggcccagcgggagttcgtaagtcgcctacccgaagaggtaggtttcagcttcgct
ccgggagcactttacgcccgccggggcttaaaagaactcgagcccatgctttaccgctgc
acccttcttttcctcactcaggcggagctggaaaccatgacgggagaaggggtactttta
aacggcgcccgcctcctgctcaatctaggggtgcgcgtggtggtggtaactctaggtgga
gaggggagtgtggtggtgactcccggaggctgtgactaccagacggccctggcccagagg
gtggtagacaccaccggcgcgggcgacggctttgcggccggcatgctttatggctacctt
aagggctggccactggagctggctcatcggttggccagcatagtggcagcttttgtggtg
gagaactggggagctcgggcaggtatgccttcgctagaggaagctaagaagcgctacgaa
gctacttttgggctcccctttccagaataa

DBGET integrated database retrieval system