KEGG   Ammonifex degensii: Adeg_1156Help
Entry
Adeg_1156         CDS       T00994                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
adg  Ammonifex degensii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Adeg_1156
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Adeg_1156
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Adeg_1156
Enzymes [BR:adg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Adeg_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1173105..1173902)
Genome map
AA seq 265 aa AA seqDB search
MNRIARTFSSLREKGQKALIVYVTAGDPSLEATAAIIPALVEAGADLVEIGIPFSDPLAD
GPVIQAASSRALAKGARLDGILEMTKALRERLPDLPLVFMTYYNPVLQRGLTRFCRQAKE
AGVDGLIVPDLPYEESGPLLREASAQGLALIPLVAPTSTEKRVEAICSSAQGFVYCVSVT
GVTGMREKLDQELGRLVQTVKKHTSLPVVVGFGIACPKTAAEVAQLADGVVVGSAVVKLL
GEGAVEEALALVRSLAQVLHARCST
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcatcgcccgaactttttcctctttgcgcgagaaagggcaaaaggcgctcatc
gtgtacgtcacggccggcgaccccagcctggaagccaccgctgccatcatccccgccctg
gtagaggccggtgctgatcttgtcgagatagggatccctttttccgacccgctggccgac
ggaccagtgattcaggccgcctcctcccgggccctggccaaaggagcaaggcttgacggc
atcctggagatgacaaaagctttaagggagcgcttgccggacttgccgcttgtcttcatg
acctactacaaccccgtgctccagcggggtctgacaaggttctgccgccaggccaaagag
gccggggtggacgggttgatcgttcccgatctaccctacgaggaaagcgggccgcttcta
agggaggcttcggcccagggtttagccctcatccctctggtggcgcctaccagcaccgaa
aaacgcgtggaagccatctgctcgtcggctcagggattcgtatactgcgtctcggtgacc
ggcgttaccgggatgagggaaaagctcgaccaggagctcggccggctcgtccagacggta
aagaagcacacctccttgccagtggtggtaggtttcggcatcgcctgccccaaaactgct
gccgaggtagcccagctggctgatggcgtggtggtaggaagtgcggtagtgaagcttttg
ggtgagggagccgtggaggaggccctagccctggtgaggtccctggcgcaagtcctgcac
gctcgttgttcaacttag

DBGET integrated database retrieval system