KEGG   Ammonifex degensii: Adeg_1156Help
Entry
Adeg_1156         CDS       T00994                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
adg  Ammonifex degensii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Adeg_1156
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Adeg_1156
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Adeg_1156
Enzymes [BR:adg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Adeg_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1173105..1173902)
Genome map
AA seq 265 aa AA seqDB search
MNRIARTFSSLREKGQKALIVYVTAGDPSLEATAAIIPALVEAGADLVEIGIPFSDPLAD
GPVIQAASSRALAKGARLDGILEMTKALRERLPDLPLVFMTYYNPVLQRGLTRFCRQAKE
AGVDGLIVPDLPYEESGPLLREASAQGLALIPLVAPTSTEKRVEAICSSAQGFVYCVSVT
GVTGMREKLDQELGRLVQTVKKHTSLPVVVGFGIACPKTAAEVAQLADGVVVGSAVVKLL
GEGAVEEALALVRSLAQVLHARCST
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcatcgcccgaactttttcctctttgcgcgagaaagggcaaaaggcgctcatc
gtgtacgtcacggccggcgaccccagcctggaagccaccgctgccatcatccccgccctg
gtagaggccggtgctgatcttgtcgagatagggatccctttttccgacccgctggccgac
ggaccagtgattcaggccgcctcctcccgggccctggccaaaggagcaaggcttgacggc
atcctggagatgacaaaagctttaagggagcgcttgccggacttgccgcttgtcttcatg
acctactacaaccccgtgctccagcggggtctgacaaggttctgccgccaggccaaagag
gccggggtggacgggttgatcgttcccgatctaccctacgaggaaagcgggccgcttcta
agggaggcttcggcccagggtttagccctcatccctctggtggcgcctaccagcaccgaa
aaacgcgtggaagccatctgctcgtcggctcagggattcgtatactgcgtctcggtgacc
ggcgttaccgggatgagggaaaagctcgaccaggagctcggccggctcgtccagacggta
aagaagcacacctccttgccagtggtggtaggtttcggcatcgcctgccccaaaactgct
gccgaggtagcccagctggctgatggcgtggtggtaggaagtgcggtagtgaagcttttg
ggtgagggagccgtggaggaggccctagccctggtgaggtccctggcgcaagtcctgcac
gctcgttgttcaacttag

DBGET integrated database retrieval system