KEGG   Ammonifex degensii: Adeg_1157Help
Entry
Adeg_1157         CDS       T00994                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
adg  Ammonifex degensii
Pathway
adg00260  Glycine, serine and threonine metabolism
adg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
adg01100  Metabolic pathways
adg01110  Biosynthesis of secondary metabolites
adg01130  Biosynthesis of antibiotics
adg01230  Biosynthesis of amino acids
Module
adg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Adeg_1157
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Adeg_1157
Enzymes [BR:adg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Adeg_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Sigma70_r1_2
Motif
Other DBs
NCBI-ProteinID: ACX52274
UniProt: C9RDE7
Position
complement(1173899..1175086)
Genome map
AA seq 395 aa AA seqDB search
MLPDKRGYFGPYGGRFVPETLMPALEELEKAYLSWCDDPSFRRELAWYLRHYVGRPTPLY
YASRLTEALGGARIYLKREDLNHTGAHKINNTIGQALLARRMGKKRIIAETGAGQHGVAT
ATAAALLGCECVIYMGAVDIERQRLNVIRMKLLGAEVVPVAAGSGTLKDAMNEAIRDWVT
NVRTTYYLIGSVAGPHPYPMMVRDFQSVIGQETRRQVLQAAGKLPDVIIACVGGGSNAMG
IFYPFLAEPGVKLIGVEAGGRGEGPGEHAATLCRGRPGVLHGSYSYLLQDEEGQISPVHS
IAAGLDYPGVGPEHAYLKETGRVTYLTASDEEALEAFELLSRTEGILPALESAHALAVAR
KIAPSLPREAVVVVNLSGRGDKDVETVAQAKGVGE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccgataagcgcggttacttcggtccttacggcggccgcttcgtgccggagacc
ctgatgccggccctggaggagctggaaaaagcttatctctcctggtgcgacgatccttct
ttccggcgggagctggcctggtacctgcgccactatgtgggacgccccaccccgctttac
tatgcctcccgcctcacggaggctctgggcggggcacggatctatctcaagcgggaagat
cttaatcacactggggcgcacaagatcaataacaccatagggcaggcgctgctggcccgc
cggatggggaagaagcgcatcatcgcggagacgggggcgggacagcacggcgtggccact
gccacggcagcagctttgctgggctgcgagtgtgttatctatatgggggcggtggacata
gagcgccagcggttgaacgtgatacgcatgaagcttctgggtgccgaagttgtgcccgtc
gccgcaggcagcggtaccctcaaggacgctatgaacgaggccataagggactgggtgacc
aacgtccgcaccacctactacctcatcggctcggtggccggccctcacccctaccccatg
atggtgcgcgacttccagtccgtaatcggccaagagacgcggcgccaggtcctgcaggcg
gccggcaagctccccgacgtcataatcgcctgtgtaggagggggctccaatgccatgggg
atcttctaccccttcctcgccgaaccaggggtgaagctcatcggggtagaggccggggga
agaggagaggggccgggggagcacgcggctaccttgtgccggggtcgacccggggtgcta
cacggctcctacagctacctcctccaggatgaagaagggcagataagtccggtgcactcc
atagccgccgggttagattaccccggagtaggaccggagcacgcttatcttaaggaaacg
ggaagggtcacctacctcaccgccagcgacgaggaggctttggaggcctttgagctcctt
tcccgcaccgagggcattcttcctgccctggagagcgcccacgccttggcggtggccaga
aagatagccccttccctcccgcgcgaggcggtagtggtggtaaacctctcgggacggggt
gacaaggacgtggagacggtggcccaagctaagggggtgggggaatga

DBGET integrated database retrieval system