KEGG   Ammonifex degensii: Adeg_1192Help
Entry
Adeg_1192         CDS       T00994                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
adg  Ammonifex degensii
Pathway
adg00010  Glycolysis / Gluconeogenesis
adg00071  Fatty acid degradation
adg00350  Tyrosine metabolism
adg00625  Chloroalkane and chloroalkene degradation
adg00626  Naphthalene degradation
adg01100  Metabolic pathways
adg01110  Biosynthesis of secondary metabolites
adg01120  Microbial metabolism in diverse environments
adg01130  Biosynthesis of antibiotics
adg01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeg_1192
  Lipid metabolism
   00071 Fatty acid degradation
    Adeg_1192
  Amino acid metabolism
   00350 Tyrosine metabolism
    Adeg_1192
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Adeg_1192
   00626 Naphthalene degradation
    Adeg_1192
Enzymes [BR:adg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Adeg_1192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACX52303
UniProt: C9R7M4
Position
1209046..1210044
Genome map
AA seq 332 aa AA seqDB search
MRAMLLHKPRPIEEQPLVLTELPEPEPGPGQVRLRVEVCGVCHTDLHTVEGDLPLPKLPL
IPGHQVVGIVDAVGEGVARVKVGDRVGVPWLYHTCGSCRFCRNGQENLCEKGRFTGYHVD
GGYAEFMVAEEDFVCPLPPELEPVKAAPLLCAGIIGYRALKLSGIKPGGKLGLYGFGASA
HLAIQVATYWGCEVFVFSRGAHHRELARELGAVWTGTPQESPPEKLDSSIIFAPAGWLVP
LALEHLDKGGVLVLAGITMTDIPQLKYELLYHERVVCSVANATRQDAREFLALAAVIPVK
TTVETFPLEEANEALQKLKAGKINGAGVLVIG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggcgatgcttttgcataaaccccgtcctattgaggagcagccgctggtcttgacc
gagctgcccgagcccgaaccgggtccgggtcaggtgcgcctgcgcgtggaggtctgcggg
gtttgccacaccgatctgcatacggtggagggagacctgcccctgcccaagctccccttg
atacccgggcaccaggtggtggggatagtggacgccgtaggcgaaggggtagcccgggta
aaggtgggagatcgagtaggagtcccttggctttatcacacctgcggttcctgtcgtttt
tgccgcaatgggcaggaaaatctctgcgaaaaaggccggttcaccggctaccacgtagac
ggcggctacgccgagttcatggtggcggaagaggattttgtctgccccctgcctccggag
ctcgagccggtaaaggctgctccccttctctgcgcaggaataatcggctaccgcgccctg
aaactcagcgggattaagcccggagggaagttaggtctttacggcttcggggcttctgcc
cacttggccattcaggtggccacctactgggggtgcgaggtcttcgtcttcagccgtggc
gcccatcaccgggagctggcccgcgagctgggggcggtctggaccggcacccctcaggaa
agcccgccggagaagctcgacagctccataattttcgccccggcaggctggctcgtgccc
ctggcactcgagcacttagataagggtggggtactcgtcctggccgggatcaccatgacc
gacattcctcaacttaaatatgagctcctttatcacgagcgagtggtgtgcagtgtggcc
aacgccacgcgccaggatgcccgggaatttctggccctggcggccgttatcccggtgaag
actaccgtggaaaccttccccttggaagaagccaacgaagccctgcagaaattgaaagca
gggaaaattaacggtgccggagtcctggtaataggctaa

DBGET integrated database retrieval system