KEGG   Ammonifex degensii: Adeg_1234Help
Entry
Adeg_1234         CDS       T00994                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
adg  Ammonifex degensii
Pathway
adg00010  Glycolysis / Gluconeogenesis
adg00030  Pentose phosphate pathway
adg00051  Fructose and mannose metabolism
adg00052  Galactose metabolism
adg00680  Methane metabolism
adg01100  Metabolic pathways
adg01110  Biosynthesis of secondary metabolites
adg01120  Microbial metabolism in diverse environments
adg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeg_1234
   00030 Pentose phosphate pathway
    Adeg_1234
   00051 Fructose and mannose metabolism
    Adeg_1234
   00052 Galactose metabolism
    Adeg_1234
  Energy metabolism
   00680 Methane metabolism
    Adeg_1234
Enzymes [BR:adg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Adeg_1234
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Adeg_1234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACX52345
UniProt: C9R7R6
Position
complement(1246515..1247621)
Genome map
AA seq 368 aa AA seqDB search
MARAKVSIKRIGILTGGGDAPGLNAVIRAAVKVAVRNYGLSVIGFEDGFAGLVENRSRRL
TLKDVVGILPRGGTILGTTNRENPFHYPVRENGEIVYKDLSQQAIDNLNSLGVQALIIIG
GDGSLKIAKEIWERYNFPVIGVPKTIDNDIAATDQTFGFDTAVATATEAIDKLHTTAEAH
HRVMVLEVMGRYTGWIALHAGVAGGADVILIPEIPFTIDKVCEKILERQREGKKFSIVVV
AEGAKPVGGEVVVKKIVKESFESIRLGGIGNVVGEQIERITGIETRVTVLGHLQRGGSPT
PFDRLLATRFGAAAVNFLMEGRFGEMVSLRTPDITSVPLAEAVGTMRRVPLGCDLIRAAR
QMGISFGD
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggccagggcgaaggtgtcgatcaagcggataggtattcttaccgggggaggagacgca
cccgggcttaatgcggtgatccgggcggccgtcaaggtagcggtgcgcaactatgggctg
agcgttatagggtttgaggacggcttcgcggggctggtggagaaccggagccgtcgcctt
accctcaaggatgtagtgggcatcctaccccgcggtgggaccatcttggggacgaccaac
cgggaaaaccccttccattacccggtgcgggaaaacggggagatcgtttacaaggacctt
tctcagcaagcgatagacaacctcaactctttaggtgtccaagccctgatcatcatcggc
ggtgacggcagccttaagatcgctaaagagatatgggagcgctacaacttcccggtcatt
ggagtacctaagaccatagacaatgatatcgcggctaccgaccagaccttcggcttcgac
acagcggtagccacggccaccgaagctatagacaagcttcatactacggctgaggcccac
caccgggtgatggtgctggaggtgatgggacgctacaccggctggatagctctgcatgcg
ggcgtggctggaggagccgacgtgattctcatcccggagattcccttcaccatcgataaa
gtgtgtgagaagatcctggagcgccagcgggaggggaaaaagttcagcatcgtggtagta
gccgaaggggccaagcccgtgggcggggaagtggtggttaagaagatcgtgaaggagagc
ttcgagagtataaggcttggcggtatcggcaacgtggtgggagagcagatagagaggatc
accggcattgaaactcgcgtgacggtgctagggcacctgcagcgaggaggatcgcctact
cccttcgaccgcctcctagccacccgtttcggagcggcggcagtcaatttcctgatggag
gggcgcttcggcgagatggtctccctccggactcccgatatcacctccgttcccctggcc
gaagcagtgggaactatgcgtcgggttcccctgggctgcgacctcatccgggcggcgcgc
cagatggggataagctttggtgattaa

DBGET integrated database retrieval system