KEGG   Ammonifex degensii: Adeg_1257Help
Entry
Adeg_1257         CDS       T00994                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
adg  Ammonifex degensii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Adeg_1257
Enzymes [BR:adg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Adeg_1257
Exosome [BR:adg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Adeg_1257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1265824..1266798)
Genome map
AA seq 324 aa AA seqDB search
MTYPYHRPRRLRRLENLRRLVRETELAVKDLLWPLFVVEGERVRQPVESMPGVFRYSVDQ
LLGELEEAVELGLPGVLLFGVTDRKDPQGSEAWNREGVVPRAIRAIKARFPELVVAADVC
LCPYTDHGHCGVVEEGRVLNDPTLPLLARAAVTYAEAGADLVAPSDMMDGRVRAIREALD
AAGFQEVGIMAYSAKYASAFYGPFREAAESAPRFGDRRSYQMDPANAAEALWEVELDLEE
GADIVMVKPALAYLDVIRQVKDAFGRPVAAYNVSGEYAMIKAAAKLGWLDEKAVVLEVLT
AIKRAGADIIITYFAKEAARWLRR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttgacctatccttaccaccggccacgccgtctgcgccggctggaaaacctgcggcgctta
gtacgggagaccgaacttgcggtaaaagatcttctctggccgctcttcgtggtggaaggg
gaaagggtaaggcagccggtggagtccatgcccggcgtttttcgctactccgtagaccaa
ctcctgggcgaactggaggaagcggtggagctgggcctgccgggagtcttgcttttcggc
gttaccgaccgcaaagacccccagggaagcgaggcctggaaccgggagggtgtggttccg
cgggccatacgggcgattaaagcccgctttcccgagctggtggtggcggctgacgtctgc
ctctgcccttataccgaccacggccactgtggggtggtcgaagaagggcgcgtgctcaat
gaccccacccttcctcttttggcgcgggcggcggtgacctacgccgaggcgggagccgac
ctggtggccccgtcggacatgatggacgggagggtgagggccataagagaggcgctggac
gcagccggctttcaggaagtagggatcatggcttacagcgccaagtacgcctctgccttc
tatggtcccttccgggaggcggcggaaagcgccccccgctttggcgaccgccgcagctac
cagatggaccctgccaacgcagccgaggccctctgggaagtggagcttgacctggaagag
ggggccgatatagtaatggtgaagccggccctggcttacctggatgtcataaggcaggtg
aaagacgcctttgggcgcccggtggcggcctataacgtgagcggggagtacgccatgata
aaggcggcggcaaagctcggctggcttgacgagaaggcggtagtgctggaggtgctcacc
gccataaagcgggcgggggccgatatcatcataacctactttgctaaggaggcggcccgc
tggctgcgcaggtaa

DBGET integrated database retrieval system