KEGG   Ammonifex degensii: Adeg_1631Help
Entry
Adeg_1631         CDS       T00994                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
adg  Ammonifex degensii
Pathway
adg03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Adeg_1631
Enzymes [BR:adg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Adeg_1631
DNA repair and recombination proteins [BR:adg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Adeg_1631
    RecFOR pathway proteins
     Adeg_1631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_5 RuvA_N RuvA_C HHH 5_3_exonuc DNA_pol_lambd_f HHH_2 HHH_8 PG_binding_2 IMS_HHH Cdd1 DUF3173 AAA_30
Motif
Other DBs
NCBI-ProteinID: ACX52725
UniProt: C9R8U6
Position
complement(1618378..1618959)
Genome map
AA seq 193 aa AA seqDB search
MLAFLRGSVLEKERGRAVILVGGMGLEVFLPLSLYERLPAKGGEVELYTCLLLREDRPEI
YGFGDREERDFFLRLLKIGGVGPKTALALLSCFSVEELREAIRSEDLEKLTVVPGVGKKT
ARRLLLELKEEKGAPVEGEAAADAVAALINLGYRRREAEEAVREAKARGAQGIEELLKLS
LAYLGRRKEGKEA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgctagcttttttgcgcggctcggtgctggaaaaggagcgggggagagcagtaatcttg
gtgggaggaatggggctggaggttttcctccccctttccctctacgagcgcctgccggcc
aagggaggagaggtcgagctttatacctgcctgcttttgcgggaggatcggccggaaatt
tacggcttcggcgaccgggaagaaagggattttttcttacgcctcttgaaaatcggtggg
gtgggccccaaaacggctctggcgctcctctcctgcttctcggtggaagagctgcgcgag
gcgataagaagcgaggatctagaaaagcttaccgtggttcccggtgtaggaaagaaaacg
gcccggcggttactgctagagctgaaggaagaaaagggtgcgccggtagagggggaagcg
gcggccgatgctgtagcggccctcataaacctgggctatcgccgccgggaggccgaagaa
gcggtgcgggaagccaaggccaggggggcgcaaggaatagaggagttgcttaagttaagc
ctggcttatctagggcgccggaaggaaggtaaagaagcatga

DBGET integrated database retrieval system