KEGG   Ammonifex degensii: Adeg_1631Help
Entry
Adeg_1631         CDS       T00994                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
adg  Ammonifex degensii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:adg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1618378..1618959)
Genome map
AA seq 193 aa AA seqDB search
MLAFLRGSVLEKERGRAVILVGGMGLEVFLPLSLYERLPAKGGEVELYTCLLLREDRPEI
YGFGDREERDFFLRLLKIGGVGPKTALALLSCFSVEELREAIRSEDLEKLTVVPGVGKKT
ARRLLLELKEEKGAPVEGEAAADAVAALINLGYRRREAEEAVREAKARGAQGIEELLKLS
LAYLGRRKEGKEA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtgctagcttttttgcgcggctcggtgctggaaaaggagcgggggagagcagtaatcttg
gtgggaggaatggggctggaggttttcctccccctttccctctacgagcgcctgccggcc
aagggaggagaggtcgagctttatacctgcctgcttttgcgggaggatcggccggaaatt
tacggcttcggcgaccgggaagaaagggattttttcttacgcctcttgaaaatcggtggg
gtgggccccaaaacggctctggcgctcctctcctgcttctcggtggaagagctgcgcgag
gcgataagaagcgaggatctagaaaagcttaccgtggttcccggtgtaggaaagaaaacg
gcccggcggttactgctagagctgaaggaagaaaagggtgcgccggtagagggggaagcg
gcggccgatgctgtagcggccctcataaacctgggctatcgccgccgggaggccgaagaa
gcggtgcgggaagccaaggccaggggggcgcaaggaatagaggagttgcttaagttaagc
ctggcttatctagggcgccggaaggaaggtaaagaagcatga

DBGET integrated database retrieval system