KEGG   Ammonifex degensii: Adeg_1743Help
Entry
Adeg_1743         CDS       T00994                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
adg  Ammonifex degensii
Pathway
adg00030  Pentose phosphate pathway
adg01100  Metabolic pathways
adg01120  Microbial metabolism in diverse environments
adg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Adeg_1743
Enzymes [BR:adg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Adeg_1743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C Symplekin_C
Motif
Other DBs
NCBI-ProteinID: ACX52832
UniProt: C9R953
Position
1736375..1738126
Genome map
AA seq 583 aa AA seqDB search
MILEGPVNVLKIDLESSSWKLEEREDLVGWLGGVGVATQLFMEEAAWDKPPLAPEQPIIF
AIGPFSGIYPLATKVVAVFRSPLTEEWGESYAGMRAAIALRFAGYDAVVIKGKAPRPTYL
VIDEKGVAFKDARGVWGLDTEETGRLLREFEGGRGRRSIWRIGPAGENLVPLAGVNVDTY
RHFGRLGLGALLGSKNLKALVVLGNRSYPIKNPTAYNRVYEKIYRAVVGTPLLSKYHYIG
TAENILALNAQGSLPTLNLKASRFEKAEEVSGERFGRESLFRILACAGCPLGCIHVGVYR
RPHPKGAGYISTTLAYDYEPIYALGPMLGLDAVDKVYALLREVEASGLDVISTGVVLAWA
TEALERGVVSEKETLVPLRFGAVESYIQATQYLAQPPNDFYRALGRGLRYATRIYGGEDF
ALILGGHEMAGYHTGYAFLLGQSVGARHSHLCNAGYSFDQTRKGDYTPEELVQYLLEEEA
WRNVLNSLVICLFARKAYTPEVTAEALQALGRETDPQELMILGRKILRQKWEAKKRLGYT
LDQIPLPPRRYFETPSGQGLLDPETYAALLKLYREKFASFLNA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
ttgattctggaaggtccggtgaacgtactcaagatagacctggagagtagctcctggaag
ttggaggagcgggaagacttggtcggctggctgggaggggtaggggtggccacccagctc
tttatggaagaggccgcctgggacaagccccctctggcaccggagcagccgatcattttc
gccatcggccccttctccggcatttacccactggccaccaaggtggtggccgtttttcgc
tccccgctcaccgaagagtggggggagagctacgccggaatgcgggcggccatcgccttg
cgcttcgccggctacgacgcagtggtgataaagggaaaagctccgcggcctacctacttg
gtgatcgacgagaagggggtagccttcaaagacgcccgcggggtctgggggctcgacacg
gaggaaacaggacgcctgctgcgggagttcgaagggggaaggggaagacgcagcatctgg
cgcataggcccggcaggagaaaatctggtgcccctggctggggtgaacgtggacacctat
cgccacttcgggcgcctgggcctgggggccttgctgggaagtaaaaacctcaaggccctg
gtggttttgggcaaccgcagctaccccataaagaatcccactgcttacaaccgggtctac
gaaaagatctaccgcgccgtggtaggaacccctttgctcagcaagtaccactatatcggc
acggcggaaaacattctggcgcttaacgctcagggaagtctgccgaccttaaatctcaag
gcttcccgttttgagaaggcagaagaggtaagcggggagcgcttcggtagggagagctta
ttccgcattttggcctgcgccggttgtcccctgggctgcatccacgtgggggtttaccgc
cgcccccaccccaagggagcaggctacatctccactactttggcctacgactacgaaccc
atctatgccctcggccccatgctggggcttgacgcggtagataaagtgtacgctttgttg
cgggaagtagaggcttcagggctggacgtaatctctactggggtggtgctggcctgggcc
accgaggctttggagcggggagtggtgtcggagaaagaaaccttggttcctctgcgcttc
ggcgcggtagaaagttatatccaagcaacacagtacctggcacagccccccaatgatttt
taccgcgccttgggccgagggcttaggtacgccacccggatctacgggggcgaggatttc
gccctcattttaggcgggcacgagatggcagggtaccacaccggctacgccttccttctg
gggcagagcgtgggagcacgccactcccacctctgcaacgccggctacagcttcgaccag
acccgcaagggagactataccccggaagagctggtgcagtacctcctagaggaagaagcc
tggcgcaacgtgctgaactccctggtaatctgtctcttcgcccgcaaggcgtacacgcct
gaagtcaccgccgaagcgcttcaggccctgggccgggagacagacccccaggagctcatg
atcttggggagaaaaatcctgcggcagaagtgggaggccaagaagcgcctgggctacacc
ttagaccaaattcctctcccgcccaggcgttacttcgaaaccccctcggggcaaggtctg
ctcgaccccgagacttacgccgctttattgaagctttaccgggaaaagtttgcttctttc
cttaatgcatga

DBGET integrated database retrieval system