KEGG   Ammonifex degensii: Adeg_1846Help
Entry
Adeg_1846         CDS       T00994                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
adg  Ammonifex degensii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Adeg_1846
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeg_1846
   00620 Pyruvate metabolism
    Adeg_1846
   00640 Propanoate metabolism
    Adeg_1846
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Adeg_1846
   00680 Methane metabolism
    Adeg_1846
Enzymes [BR:adg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Adeg_1846
Lipid biosynthesis proteins [BR:adg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Adeg_1846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1844045..1846123)
Genome map
AA seq 692 aa AA seqDB search
MAQEAARPLEAGAQEKIYEEFDHRIVPPSWQDRVWSAEEYKRFHAETVKDKAAIEAFWAE
WAEKLPWFKKWDKVLDDSNPPFYRWFVGGETNLAYLAVDWQIKQGRRHKVAFIWEGEPWD
EVKREPKEVRKITYHDLYRESNRLAFALREKLRVRKGEVVTLYLPMIPEIVFYMLAVQRL
GAAHSIVFSGFSAQALAQRVLDAGSRIIVTADGLYRRGRVIPLKPMVDEAVRICAEKGHK
VEHVIVVRRVGLENLAWEEERDLWHHRFVRGISRNVQVEPVPCGSEDFSFILYTSGTTGT
PKGVQHSVGGYAVGVYTSTKLIFDLNDEDVYWCTADVGWITGHSYVIYGPLMLGATSVIY
EGAPDYPAPDRWWNIIHRHGVTVFYTAPTAVRMLMKFPEEFVHRYDLSTLRIVNTVGEPI
NPEAFNWYFRNLGKENIVASSCWWMTETGQMILAHTPGLGKIYPLKPGTNGLPLPGVNVE
VVDDEGKPCPPGVRGHLVVTTPWPAMMMTIYKDPQRYVDTYWSRFKDRFCTSDFAVKDPD
GYVWVLGRADDVLKIAGHRIGTAEVESAMVLHPAVAEAACVGRPDPVKGEVPVIFTVLRH
GFMGEPELVDEIKQHLRKVIGPIVATDAVIVFVDNLPKTRSGKIMRRILRAVIHGQPLGD
VTTLEDGVAVEEATKAYQQIKAALRETAATGQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggaggcggcgcggccgctggaagcgggcgctcaggagaagatctatgaggaa
ttcgaccaccgcatcgtgcctcccagttggcaggacagggtctggagtgcggaggaatac
aagcgctttcatgccgaaaccgttaaggataaagcggccatagaagctttttgggcagag
tgggccgagaaacttccctggttcaaaaagtgggacaaggtgctggatgatagcaatcct
cccttctaccgctggtttgtagggggagagaccaacctggcttatttggccgttgactgg
cagatcaagcagggaagaaggcacaaggtggccttcatctgggaaggggagccctgggac
gaggtaaagcgcgagcccaaagaggtaaggaagatcacctaccacgacctttaccgggag
tcgaaccgcttggccttcgctttaagggaaaagctccgggtacgcaagggagaagtcgtc
actctttaccttcccatgattccggaaatagttttctacatgctggcagtgcagcgcctg
ggagcggctcatagcattgtcttttccggcttcagcgcccaggccttggcccagcgggtt
ctggatgccggttcgcgcatcatagtcaccgccgacggtctttaccgccggggccgggtc
atacccttgaaacccatggtggatgaggcagtacgcatttgtgcggagaaagggcacaag
gtggagcacgtcatcgtggtgaggcgcgtggggctggagaacctggcctgggaagaggag
cgcgatctttggcaccaccgcttcgtgagaggcatcagccgcaatgtgcaagtggagccg
gtaccctgcggttcagaagatttcagctttatcctctacacctccggaaccacgggtacg
cctaaaggggtccagcactcggtagggggctacgccgtaggtgtctatacctccaccaag
ctcattttcgaccttaacgacgaagacgtttactggtgcacggcagacgtgggctggatt
accgggcacagctatgtgatttacggtcctctgatgctgggggctacttctgtgatctac
gaaggggcacctgactacccagctcccgaccgctggtggaacatcattcaccggcacggg
gtgacggttttctacactgctcccacggcggtgcgcatgctcatgaagttccccgaagag
tttgtgcaccggtatgatctttctaccctgcgcatcgtcaacacggtgggcgagcccatc
aaccccgaagctttcaactggtacttccgcaacctgggcaaggagaacatcgtggcttcc
agctgctggtggatgaccgagaccggccagatgatcctggcccacaccccgggtctaggc
aagatttaccccctcaagcccggaaccaacggccttcccttacccggcgtcaacgtagaa
gtagtagacgatgaaggtaagccctgccctccgggggttcgcggtcacctggtggttacc
accccctggccagctatgatgatgacgatctacaaggatccgcagcgctacgttgatacc
tactggagcaggttcaaagacaggttctgcacttctgactttgccgttaaagacccggac
ggctacgtctgggtgctggggcgggccgacgacgttttgaagattgcgggtcaccgcatc
ggtacagcagaggtggagtcggccatggtgttgcacccggcggtggcggaggcggcctgc
gtgggccgtcccgacccggtcaagggagaggtcccggtcatcttcaccgtgctgcgccat
gggttcatgggcgagccggagctggtggacgagatcaagcagcacctgcgcaaggtcatc
ggtcccatcgtagccaccgacgcggtaatagtcttcgtggataacctgcccaagacccgc
agcggcaaaatcatgcgtcgcatcctgcgggcggtgatccacggccagccgctgggcgac
gtcaccactctggaagacggggtggcggtggaggaagccactaaggcctaccagcagata
aaagccgccttgcgtgagacggcggctaccggacaataa

DBGET integrated database retrieval system