KEGG   Ammonifex degensii: Adeg_1852Help
Entry
Adeg_1852         CDS       T00994                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
adg  Ammonifex degensii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:adg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:adg00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:adg00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:adg00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:adg00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:adg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1851371..1853341)
Genome map
AA seq 656 aa AA seqDB search
MARQKEAVLPEEQIFYPPERFARQANVKSREIYAKAQASPELFWALQAERLDWFRKWDKV
LEWDPPFARWFVNAKLNACYNCVDRHLKTWRRNKAALIFEGEPGDTRVLTYWDLYREVGR
LASALRKLGVEKGDRVAIYLPMIPELPIAMLACARIGAPHLVVFGGFSAEALRDRINDAG
AKVLITADGGWRRGKIVPLLRNARLALEEAPSVEKVVVVKRIGQELELDPQRECWYHELV
AEESPCSPEEVDSEDMLFLLYTSGTTGKPKGIVHTTGGYLVGVTATLHMTFDLKEEDVYW
CTADCGWITGHSYLVYGPLANGATVLLYEGAPDWPRPDRFWQIIDRYGVTIFYTAPTAIR
AFMRWGEQWLDGYDLSSLRLLGTVGEPINPEAWLWFYQYVGRGKCPIVDTWWQTETGMHI
IAALPGITPLKPGSATVPLPGLKVDVVDKEGNPLPPGEEGLLVIKEPWPAMMRTVYGDEE
RYVKEYWGRFPGKWYYFSGDGARKDSHHYFWILGRVDDVINVAGHRLSTMELESALVEHP
AVAEAAVIGKAHEIKGQAVVAFVTLKDEVFAEIKSGKRSWQAMEEELKAHVTAKIGAIAR
PDAVYFTAELPKTRSGKIMRRLLRAIAEGKVLGDVSTLANPEVIAELKRRYGDQEV
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggctaggcagaaagaagcggttctgccggaggaacagatcttttatcctccggaaagg
tttgcccggcaggctaacgtcaagagccgggaaatatatgcgaaagcgcaggccagtccc
gaacttttctgggccttgcaggccgaacgcctggactggttcagaaaatgggataaagtg
ctggaatgggatcccccctttgcccgctggttcgtcaacgccaagctcaacgcctgctac
aactgtgtggacaggcacctcaagacctggcggcgcaacaaggcagccctgatttttgaa
ggggagccgggggatacgcgggtgctaacctactgggatctctaccgggaagtggggcgg
ctagcctcggcgctcaggaagctgggagtggagaaaggggaccgagtggcaatctacctt
cccatgattcccgagcttcccattgccatgctggcctgtgcccgcataggagctcctcat
ctcgtggttttcgggggcttcagcgccgaggctctgcgcgaccggataaacgacgccggg
gctaaagtgctcatcaccgccgacggcggctggcgccgggggaaaatagtacctttactc
cgaaatgccaggctggccctggaagaggccccttcggtggagaaggttgtggtagtgaag
cggataggacaggagctggaactcgatcctcaaagggagtgctggtaccacgagctggtg
gcagaagagtccccctgctcgccggaagaggtcgatagcgaggatatgctcttcctcctt
tacaccagtggcactacgggaaagcccaagggcatagtccacaccacgggcggctactta
gtaggagttacggccaccctgcacatgacctttgacctcaaggaagaggacgtctactgg
tgcacggcggactgcggctggatcaccggtcacagctacctggtctatggccccctggcc
aacggggctacggtactcctttacgagggagctcccgactggccccgccccgaccgcttc
tggcagatcatcgaccggtacggggtcaccattttctacacggctcccacggccataagg
gccttcatgcgctggggagagcaatggctggacggctacgatctttccagcctgcgtctt
ctgggtaccgtgggtgaacccatcaacccagaagcctggctctggttttatcagtatgtg
ggccggggcaagtgccccatagtcgatacctggtggcagacggagacgggtatgcacatc
atcgccgctctgcccggcatcacccccctcaagccgggctcggccaccgtgcccctaccc
gggctcaaggtggacgtggtggataaagaggggaatcccttgccgccgggggaggagggc
ctgctggtgataaaggagccctggccagcgatgatgcgcacggtctacggggatgaggag
cgctacgtcaaggagtactggggcaggtttccgggcaagtggtactacttctccggcgac
ggggcgcgcaaggacagccaccattacttctggatcctgggccgagtggacgacgtcatc
aacgtggcaggacaccggctgagtaccatggagctggaaagcgccctggtggagcacccg
gcggtggcggaggcggcggtgatcggcaaggcacacgagataaaaggacaggcggtagtg
gcctttgtcactctgaaggatgaggtatttgccgagataaagagtggaaagcgcagctgg
caggcgatggaggaggaactcaaggcccacgtaacggccaagataggtgctattgcccgt
cccgacgccgtttacttcacggcggagttgcccaaaacccgtagcggcaagatcatgcgg
cggcttttgcgggccatagcggaaggcaaggtcctgggggacgtttccactttggctaac
ccggaggtcattgccgagcttaagcgtcgctatggggaccaagaggtttaa

DBGET integrated database retrieval system