KEGG   Ammonifex degensii: Adeg_1852Help
Entry
Adeg_1852         CDS       T00994                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
adg  Ammonifex degensii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:adg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Adeg_1852
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Adeg_1852
   00620 Pyruvate metabolism
    Adeg_1852
   00640 Propanoate metabolism
    Adeg_1852
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Adeg_1852
   00680 Methane metabolism
    Adeg_1852
Enzymes [BR:adg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Adeg_1852
Lipid biosynthesis proteins [BR:adg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Adeg_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1851371..1853341)
Genome map
AA seq 656 aa AA seqDB search
MARQKEAVLPEEQIFYPPERFARQANVKSREIYAKAQASPELFWALQAERLDWFRKWDKV
LEWDPPFARWFVNAKLNACYNCVDRHLKTWRRNKAALIFEGEPGDTRVLTYWDLYREVGR
LASALRKLGVEKGDRVAIYLPMIPELPIAMLACARIGAPHLVVFGGFSAEALRDRINDAG
AKVLITADGGWRRGKIVPLLRNARLALEEAPSVEKVVVVKRIGQELELDPQRECWYHELV
AEESPCSPEEVDSEDMLFLLYTSGTTGKPKGIVHTTGGYLVGVTATLHMTFDLKEEDVYW
CTADCGWITGHSYLVYGPLANGATVLLYEGAPDWPRPDRFWQIIDRYGVTIFYTAPTAIR
AFMRWGEQWLDGYDLSSLRLLGTVGEPINPEAWLWFYQYVGRGKCPIVDTWWQTETGMHI
IAALPGITPLKPGSATVPLPGLKVDVVDKEGNPLPPGEEGLLVIKEPWPAMMRTVYGDEE
RYVKEYWGRFPGKWYYFSGDGARKDSHHYFWILGRVDDVINVAGHRLSTMELESALVEHP
AVAEAAVIGKAHEIKGQAVVAFVTLKDEVFAEIKSGKRSWQAMEEELKAHVTAKIGAIAR
PDAVYFTAELPKTRSGKIMRRLLRAIAEGKVLGDVSTLANPEVIAELKRRYGDQEV
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggctaggcagaaagaagcggttctgccggaggaacagatcttttatcctccggaaagg
tttgcccggcaggctaacgtcaagagccgggaaatatatgcgaaagcgcaggccagtccc
gaacttttctgggccttgcaggccgaacgcctggactggttcagaaaatgggataaagtg
ctggaatgggatcccccctttgcccgctggttcgtcaacgccaagctcaacgcctgctac
aactgtgtggacaggcacctcaagacctggcggcgcaacaaggcagccctgatttttgaa
ggggagccgggggatacgcgggtgctaacctactgggatctctaccgggaagtggggcgg
ctagcctcggcgctcaggaagctgggagtggagaaaggggaccgagtggcaatctacctt
cccatgattcccgagcttcccattgccatgctggcctgtgcccgcataggagctcctcat
ctcgtggttttcgggggcttcagcgccgaggctctgcgcgaccggataaacgacgccggg
gctaaagtgctcatcaccgccgacggcggctggcgccgggggaaaatagtacctttactc
cgaaatgccaggctggccctggaagaggccccttcggtggagaaggttgtggtagtgaag
cggataggacaggagctggaactcgatcctcaaagggagtgctggtaccacgagctggtg
gcagaagagtccccctgctcgccggaagaggtcgatagcgaggatatgctcttcctcctt
tacaccagtggcactacgggaaagcccaagggcatagtccacaccacgggcggctactta
gtaggagttacggccaccctgcacatgacctttgacctcaaggaagaggacgtctactgg
tgcacggcggactgcggctggatcaccggtcacagctacctggtctatggccccctggcc
aacggggctacggtactcctttacgagggagctcccgactggccccgccccgaccgcttc
tggcagatcatcgaccggtacggggtcaccattttctacacggctcccacggccataagg
gccttcatgcgctggggagagcaatggctggacggctacgatctttccagcctgcgtctt
ctgggtaccgtgggtgaacccatcaacccagaagcctggctctggttttatcagtatgtg
ggccggggcaagtgccccatagtcgatacctggtggcagacggagacgggtatgcacatc
atcgccgctctgcccggcatcacccccctcaagccgggctcggccaccgtgcccctaccc
gggctcaaggtggacgtggtggataaagaggggaatcccttgccgccgggggaggagggc
ctgctggtgataaaggagccctggccagcgatgatgcgcacggtctacggggatgaggag
cgctacgtcaaggagtactggggcaggtttccgggcaagtggtactacttctccggcgac
ggggcgcgcaaggacagccaccattacttctggatcctgggccgagtggacgacgtcatc
aacgtggcaggacaccggctgagtaccatggagctggaaagcgccctggtggagcacccg
gcggtggcggaggcggcggtgatcggcaaggcacacgagataaaaggacaggcggtagtg
gcctttgtcactctgaaggatgaggtatttgccgagataaagagtggaaagcgcagctgg
caggcgatggaggaggaactcaaggcccacgtaacggccaagataggtgctattgcccgt
cccgacgccgtttacttcacggcggagttgcccaaaacccgtagcggcaagatcatgcgg
cggcttttgcgggccatagcggaaggcaaggtcctgggggacgtttccactttggctaac
ccggaggtcattgccgagcttaagcgtcgctatggggaccaagaggtttaa

DBGET integrated database retrieval system