KEGG   Ammonifex degensii: Adeg_1882Help
Entry
Adeg_1882         CDS       T00994                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3 4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
adg  Ammonifex degensii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:adg00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1880403..1881281)
Genome map
AA seq 292 aa AA seqDB search
MKDKIYLEGLLFPGRHGVLPEEQTYSQNFRLDVELCLDLRPAGKKDELHLTVNYQEAYRV
VEEVVGQRSFLLLEALAEAVAERLLSFFPLVRRVKVRVEKPGAPLPGYFERVGVEIARYR
KVKPAKALVGLGSNLGDRLQNLKAALSALGRTPGIKLEKVAPLYRSAPWGKTDQPDFFNT
VALISTFLSPFGLLASLLEIEKELGRRRENEERWGPRPIDLDLLLYEDLAVETEELVLPH
PRLTERAFVVVPLADLMPELKLPNGKGAREWADKLEQEQEIERVEGYGWERD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagataaaatttaccttgaggggttgctctttccgggacggcacggggttctgccg
gaagagcagacatacagccagaactttcgcctggacgtcgagctttgtctcgatctccgg
cctgccgggaaaaaggacgaacttcatttgacggtcaactaccaagaagcctaccgggtg
gtggaggaggtggtgggccagcgctctttcctcttgctggaggcgctggccgaggcggta
gcggaaaggcttctctcctttttcccgctggtgcggcgggtgaaggtgcgggtggaaaag
ccgggagcccccctgcccggctattttgagcgcgtgggagtggaaatcgccagataccgg
aaggtgaagcccgctaaggctttagtgggactggggagcaacttaggggataggctccag
aacttaaaggcggcgctttcggctttaggtaggactccggggataaagctggagaaagtg
gctcccctttaccgctctgccccctggggaaagacggatcagcccgatttctttaacacc
gtggccctcatttccacctttctttctcctttcggcctcctggcaagtctgctggaaata
gagaaggagttggggcgtaggcgggaaaacgaggaaaggtggggtccccgccctatcgat
ctcgaccttcttctttacgaggatctcgcggtggaaacagaggagctggttctcccccat
cctcgcctcaccgagcgggcttttgtggtagttcccctggccgatcttatgccggagctc
aagttgccgaacggtaaaggagcgcgtgagtgggcggataaacttgagcaggaacaagaa
atagaaagggtggaggggtatggatgggaaagagattga

DBGET integrated database retrieval system