KEGG   Alcanivorax dieselolei: B5T_00001Help
Entry
B5T_00001         CDS       T02259                                 

Gene name
dnaA
Definition
(GenBank) Chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
adi  Alcanivorax dieselolei
Pathway
adi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:adi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B5T_00001 (dnaA)
DNA replication proteins [BR:adi03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    B5T_00001 (dnaA)
Chromosome [BR:adi03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    B5T_00001 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA RuvB_N AAA_14 AFG1_ATPase AAA_22 ATPase_2 AAA_16 ResIII NACHT DUF815 TsaE RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFT68290
UniProt: K0C750
Position
100..1497
Genome map
AA seq 465 aa AA seqDB search
MSKTLWNRCLTRLEDELPSQQFNMWIRPLQVSVSADGAEMTLFAPNRFVVDWVRDKYMER
IGEVMGEMEQGPLPQLRLEVGSSRVTEIIPKRQAPEPRPTTAQTAETRPAPPPAPPSDVG
LAAKHRSNLNTGFTFPTFVEGKSNRMACAAAQQVAENPASHGYNPLLLYGGVGLGKTHLM
HAVGNELLRRNPNAKVVYLHSERFVADMISALRNKTINEFKRFYRSVDALLIDDIQFFAG
KEQSQEEFFHTFNALLENGQQIILTCDKFPKEVDGLEERLKSRFGWGLSQPLEPPELETR
VAILKKKAEEARIELPNDAAFFIAQRIRSNVRELEGALRRVIAHVRFTGAQIDIGLIKEA
LKDLIALQARQISIDNIQRTVAEYYKIKIPDLHSPRRTRSVARPRQVAMALSKELTSHSL
PEIGASFGGRDHTTVLHACRKVNELRETSPEIEEDYQNLLRTLTS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaaacgctttggaatcgctgtttgacgcgactcgaggacgagttgccgtcacag
cagttcaatatgtggattcgccctttgcaggtgtcggtatccgccgatggcgcggagatg
acgctattcgcgcctaatcgtttcgtggtggactgggtgcgtgacaagtatatggagcgt
atcggcgaggtcatgggggagatggagcaaggccccctgccccagttgcgtctggaggtt
ggcagctcccgggtaaccgagattatccccaaacgtcaggcgccggagcctcgcccgacg
acagcccagacggcggaaacgcgtccggcgccgccgccggctcctccctccgatgtgggg
ttggcggccaagcaccgaagtaacctcaataccggctttactttcccgaccttcgttgag
ggcaagtccaatcgcatggcctgtgccgccgcccagcaggtggcggagaacccggccagc
catggctataacccattgctgctttacggtggcgtggggctgggcaagacgcacttgatg
catgcggtgggaaacgagttattacggcgtaatcccaacgccaaggtggtttacctgcat
tccgagcgcttcgttgcggatatgatttccgcgttgcggaataagaccatcaacgagttc
aagcggttctaccgatccgtggatgcgctcttgatcgatgatattcagttttttgctggg
aaggagcagtcccaggaagagttcttccataccttcaacgctctgttggagaatgggcag
cagattattctgacttgcgataaatttcccaaggaagtggatggcctggaagaacgcctc
aagagccggttcggctggggattgtcacagcccctggagccgccggagttggaaacccgg
gtggcgatcttgaagaagaaggcggaagaagcccgtatcgagctacctaacgacgcggcc
ttctttatcgcccagcgcattcgttccaatgtgcgggaactggaaggggccctgcgccgg
gttattgcccatgtgcggtttaccggggcgcagattgatatcggtttgatcaaggaagcc
ttgaaggatctgattgcgctgcaggcgcggcagatcagtatcgataacattcagcgcacc
gtggcggagtattacaagatcaagattccggatctgcactcgccacgccgcacccgctcg
gtggcgcggccaaggcaggtcgccatggcgttgtcgaaggaattgaccagccacagtttg
ccggagattggcgccagttttggcgggcgtgatcacaccacggtgttgcatgcttgtcga
aaagtgaatgaacttcgggaaactagccccgaaattgaggaagattaccaaaatttgctg
agaactctcacgtcttga

DBGET integrated database retrieval system