KEGG   Alcanivorax dieselolei: B5T_00003Help
Entry
B5T_00003         CDS       T02259                                 

Gene name
recF
Definition
(GenBank) DNA replication and repair protein recF
  KO
K03629  DNA replication and repair protein RecF
Organism
adi  Alcanivorax dieselolei
Pathway
adi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:adi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B5T_00003 (recF)
DNA repair and recombination proteins [BR:adi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     B5T_00003 (recF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_23 AAA_21 AAA_15 AAA_29 AAA_13 AAA_16 AAA_27 ABC_tran NACHT AAA_25
Motif
Other DBs
NCBI-ProteinID: AFT68292
UniProt: K0C9F7
Position
2694..3797
Genome map
AA seq 367 aa AA seqDB search
MLTELRLSDFRNYHQADFSPSSGLNLIFGANGSGKTSLLEAIYFIGSGGRSFRGGRLSRL
VRDGASSATLFAVVDQPSGKQDRLGVRRALSGIESLKLNGQTPSALSDVATLLPVLALHP
QSVDLIFGASSVRRRFLDWGMFHVEHSFLAAWKEANSLLKQRNALLRAGKASQKELRYWD
QKLAASSATIEGLRRPYLARLKTEWRKILEMLSPDLKVNLELHNGLRPGEDYLQALIRTE
EEDRRRGFTHAGFHRADVRITKDGVVARDRVSRGQAKILSYALVLSQLPMISEANKVCTL
LVDDLGSELDQTHRDTLLRFLTMGNHQTLITAVDADHLGRATVENSGAAARMFHVEHGRI
QRISNDS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgaactccgtctctcagacttccggaattaccatcaggcggatttttccccc
tcttcggggttgaatctcattttcggcgccaatggcagcggcaagaccagcttgttggag
gccatctactttattggtagtggcgggcggtcttttcgaggggggcggctgtctcgcctg
gttcgagatggcgcgtcctccgccaccttgtttgccgtggttgatcagccatccggaaag
caggacaggctgggggtgagaagagccttatccggcatagagtcattaaagctcaatggc
cagactccctcggcattgagtgatgtggccacccttctccctgtattggcgttgcacccg
cagtccgtggatttgatatttggtgcttcttctgtacgtcgacgattcctggattgggga
atgttccacgtggaacattcttttttggcggcttggaaggaagccaactccctactcaag
cagcgaaatgcgctgcttcgtgcagggaaagcatcacaaaaggagctgcgttattgggac
cagaaactggcggctagttctgctactattgaagggttgcgtagaccgtatctggctcgc
ttgaaaacagaatggcgaaagatcctggagatgctgtctcctgatctgaaagttaatctg
gaactgcataacggtttgcgccctggtgaagactatctccaggcgctgattcgaaccgag
gaagaggaccgacgtcgaggtttcacacacgcgggcttccatcgggcggatgtcagaatc
acgaaagatggtgtggtggcccgggatcgtgtctcccgtgggcaagcaaagattttgtct
tatgccctggtgctctctcagctccccatgatctcggaagcaaacaaggtctgtactctc
cttgtggatgatctgggctctgagctggatcagactcatcgggataccctgttgcgcttt
ctgaccatggggaaccatcagacattgatcacggcggtggacgcggaccatttgggacgt
gccaccgttgaaaacagcggtgctgccgcccgaatgttccacgtggaacatggacggatt
cagcggatatcgaacgactcgtaa

DBGET integrated database retrieval system