KEGG   Alcanivorax dieselolei: B5T_00018Help
Entry
B5T_00018         CDS       T02259                                 

Definition
(GenBank) Bacterial transferase hexapeptide repeat protein
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AFT68307
UniProt: K0C9G4
Position
19824..20456
Genome map
AA seq 210 aa AA seqDB search
MSDPYREQHKLRLAYMPWLYPRLKPRHRAWAEPWQTKVQKELERLEAVHFGEHCFVAPQA
RLFAEPGRDIHVGDHSHIAADTLLHGPIRLGAHVSVNHHATLEGGAAGIEIGDHSRIAAY
VTLYAFNHGREAAALVREQPVTSRGIRIGRDVWLGARCGIVDGVTVGDHAVVAMGAVVTR
DVPAWCVVAGNPARPIGRRPGAPPEEGVER
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacccctaccgcgaacaacacaaactgcgcctggcgtatatgccctggttgtac
ccccggctcaagccccggcaccgggcctgggcggaaccctggcagacaaaggtgcagaaa
gagttggaacgccttgaagcggtgcatttcggggagcactgttttgtcgcaccgcaggcg
cgcctgttcgccgagccgggccgcgatatccatgtcggcgatcatagccatatcgccgcc
gacacattgctgcatggcccgattcggctcggggcccatgtcagcgtcaaccatcatgcc
accctggaaggcggggccgccggtatcgagatcggcgatcactcccgcattgccgcctac
gttactctttatgcctttaatcacggcagagaggccgccgccctggtccgcgagcagccg
gtgacatcccggggcattcgtattggccgggatgtctggctgggggcccgttgcggtatc
gtcgacggcgtcacggttggcgaccacgcggtggtggcgatgggggcggtggtaacccgg
gatgtgccggcctggtgtgtggtggcgggcaacccggcgcgtcccataggccgccgcccg
ggggcgccgccggaagaaggcgttgagcgataa

DBGET integrated database retrieval system