KEGG   Alcanivorax dieselolei: B5T_00020Help
Entry
B5T_00020         CDS       T02259                                 

Definition
(GenBank) Acyltransferase domain protein
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase MFS_1 MFS_3
Motif
Other DBs
NCBI-ProteinID: AFT68309
UniProt: K0C4R0
Position
21144..23015
Genome map
AA seq 623 aa AA seqDB search
MGKSVFSLLFKRRFGPFFGTQFLGAFNDNVFRQGLILLIASGVVVGTEVNTLNNVALALF
IVPFFLFSALAGQIADKFDRARLIRWIKFAEIVIMSCAALGFYFDAVYGLLVLLFFMGLQ
STFFGPIKYSIIPQHLPNEELVRGNALVEMGTFLAILLGSVSGVMLKMGGNTPLVISTAV
IGLAVLGFLCSLGIPRAPAADPGLRLNWNLWKETWHIVGYAREVKSVWMSVLGISWFWFL
GAAYTTQLKVYVDDYLMGTEGLYALLLATFSIGIGLGSFFCEKASGKRVELGLVPLGSIG
ISVFGIDLFFSYTSLTLSGQLSITEFLQQPGGYRIMADLLGVGIFGGFYIVPLFAFVQQR
SNPKHLARIIAANNILNALLMVASAAAGIIFVGVLDLTVPQFFLALALANVVVALYIYTV
VPEFLIRLLVWMLTNTIYRVKHKGLENIPEEGPCLLVCNHISYTDALLLAGAVRRPIRFV
MAKPIYDMPFLNYIFRTGKTIPIASKEKHPDIYEQAFRRVREELADDQVVCIFPEGRLTP
DGEVGAFKSGMEKIVKETPVPVVPMALSGLWGSFFSHKGGAALTRMPRRFWSRVKLAVGE
PVAPEAVDAEAVRSAVLALRERP
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagagcgtgttttccttgttgttcaaacgccggttcgggccttttttcggtacc
cagttccttggtgctttcaatgacaatgtctttcgtcaggggctgattctcttgatcgcc
tccggcgtggtcgtgggaaccgaagtcaatactctgaataacgtggcgctggcgttgttc
atcgttccgttttttctgttctccgcccttgccgggcaaatcgccgacaagtttgaccgc
gcccgtctgatccgctggatcaagttcgcggagatcgtgatcatgagttgcgccgcgctg
gggttttactttgacgcggtttacggcctgttggtgctgctgttcttcatggggttgcag
tccacgttcttcgggccgatcaagtactcgatcattcctcagcatctgcccaatgaagag
ctggtgagaggtaatgcgctggtggaaatgggcacctttctggcgattctgctcggctcg
gtttccggtgtgatgctgaagatgggcggtaatacgccactggtgatcagcaccgcggtg
attggcctggcggtgttgggttttctttgttccctgggtattccccgggcgccggcggcg
gacccgggcctgcgtcttaactggaatttatggaaggaaacctggcacattgtcggttac
gctcgcgaggtgaaatcggtgtggatgtcggtgctgggaatttcctggttctggtttctc
ggtgccgcttacaccacgcaattgaaggtgtatgtggatgactatctgatggggaccgag
ggtctgtacgcgttgttgctggccaccttttccatcggcattggcctgggctcatttttc
tgtgaaaaagcatccggaaagcgggtggagttgggtttggttccgctgggttccattggt
atcagtgtcttcggtattgatttgtttttctcctacacctcgttgactctgagcggccag
ctttcgatcacggaatttctgcaacagcccggcggttatcggatcatggccgatttactt
ggtgttggtatctttggcggtttctatatcgtgcctttgttcgccttcgtacagcaacgc
tccaatccgaaacatctggcccgcattatcgccgccaataatattctcaatgccttgctc
atggtggcttcggcggcggcgggaatcatcttcgtcggtgttctggatctcaccgtgccc
cagtttttcctggcgctggcgttggccaacgtggtggtggcgctctacatctataccgtg
gtgcccgagttccttatccgtcttctggtatggatgctgaccaacaccatctaccgggtg
aagcacaaggggctggaaaacattcccgaggaagggccttgtttgctggtgtgcaatcac
atcagctatacggatgcgctgctgctggctggtgcggtgcgtcgaccgatccgcttcgtg
atggcgaagccgatctacgacatgccttttctgaattatattttccgcaccggcaagacc
attccgatcgcctccaaggaaaaacatccggacatttatgagcaggccttccgtcgggta
cgtgaggaactggcggatgatcaggtagtgtgtattttcccggaaggccgcttgacaccg
gatggcgaagtgggcgcattcaagagtggaatggaaaaaatcgttaaggaaaccccagta
ccggtggtgcccatggcattatccggtttgtggggcagtttcttcagtcataaaggtggc
gcggcccttacccgcatgccgcggcgcttctggtcacgggtcaaacttgccgtcggcgaa
ccggtggcgccggaggccgttgatgccgaggccgtgcgaagcgcggtgttggcattgcgc
gaacggccataa

DBGET integrated database retrieval system