KEGG   Alcanivorax dieselolei: B5T_00022Help
Entry
B5T_00022         CDS       T02259                                 

Definition
(GenBank) Fumarylacetoacetate hydrolase family protein
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAA_hydrolase
Motif
Other DBs
NCBI-ProteinID: AFT68311
UniProt: K0CA86
Position
complement(23694..24365)
Genome map
AA seq 223 aa AA seqDB search
MTPNYLHRWIDGSTMDMPVGKVVCVGRNYAEHARELGNEVPEQPLLFMKPASALVSLHEP
VVLPKGQGEVHHEVEMVVMVGKTLSGETDPDRVRYAIAAYGVGLDLTLRDLQSTLKAKGH
PWERAKAFDGAAPVSGFVDARGISVRQNLEVSLEINGETRQHGHTGQMLFPTFELIAHIS
QTFRLDPGDLIFTGTPSGVAALNTGDQLTARLGNIVQVFSEIA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacgccaaactaccttcaccgttggatcgacggctcaaccatggatatgccggtgggc
aaagtagtgtgtgtgggacgtaactacgccgaacacgcccgcgaactgggtaacgaagtg
ccggaacaacccttgctgttcatgaaacccgcctccgccctggtgagcctgcatgagcca
gtggtgctgcccaaagggcagggggaagtccatcatgaagtggaaatggtggtcatggtc
ggcaaaaccctcagtggcgagaccgatcccgaccgggtccgctacgccatcgccgcctat
ggcgtggggcttgatctgaccttgcgggacttgcaaagcactctgaaggccaaagggcac
ccctgggagcgcgccaaggccttcgacggcgccgctccggtgtccggcttcgtcgacgcc
cgtggtatttccgtgcgccagaacctggaagtgtcactggaaatcaacggcgaaacccgt
cagcacggccacaccgggcaaatgctgtttcccacctttgagttgatcgcccacatcagt
cagaccttccgcctggatcccggtgacctcatttttaccggcacgcccagcggcgtggcg
gcactgaataccggcgatcagctgaccgcccggctgggcaatatcgttcaggtattttcg
gaaatcgcttaa

DBGET integrated database retrieval system