KEGG   Alcanivorax dieselolei: B5T_00023Help
Entry
B5T_00023         CDS       T02259                                 

Definition
(GenBank) Oxidoreductase with NAD+ or NADP+ as acceptor
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AFT68312
UniProt: K0C9G5
Position
complement(24406..25800)
Genome map
AA seq 464 aa AA seqDB search
MTALAHAALEHLTELLGARCLTDQDSAQRYGVDWTKVWAPAPSAVLLPETIDEVQQIVEI
ANEHGLHLVPSGGRTGLSAGAVAASGELVVAFDRMNKVLDFNAYDRSVTVQPGVITQQLQ
EYAEQQGLFYPVDFASAGSSQIGGNINTNAGGIKVIRYGMTRDWITGLKVVTGKGELLEL
NKGLIKNATGYDFRHLFIGSEGTLGFVVEATVKLARQPRNLTALVLGVPGFQEVMKVLHA
FQSELDLTAFEFFSDKAMAHVLAHGVSRPFDTDCPFYCLLEFEQVSEQTADQAMAVFERC
VEQGWVLDGVMSQSLQQLDQLWQLRERISESIAPHTPYKNDISVTIDKVPEFVEAVDTVV
QDAYPDFEIVWFGHIGDGNMHLNILKPEALPKEDFFEKCNNVSKWVFEIVERYNGSISAE
HGVGMTKKPYLGYSRSPEEIAYMKAVKRVFDPNNVMNPGKLFDL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctttagcccatgccgccctggaacacctgaccgaactgctcggtgcccgctgc
ctgaccgatcaggacagcgctcagcgctacggggtggactggaccaaagtctgggccccg
gcccccagcgccgtactgctgccggaaaccattgacgaagtgcagcagatcgtcgaaatc
gccaatgagcacggtctgcacctggtgccctccggcggccgcaccggtctttccgccggc
gccgtggcggcgtccggcgagctggtggtggcctttgaccggatgaacaaggtgctggac
ttcaacgcttatgatcgttccgtcaccgtccagcccggtgtgatcacccagcaacttcag
gagtacgccgagcagcagggcctgttctatccggtggatttcgcctccgccggctccagc
cagatcggcggcaacatcaataccaatgctggcggtatcaaggtgatccgctacggcatg
acccgggactggatcaccggcctgaaggtggttaccggcaaaggcgagctgttggagctc
aacaaagggctgatcaagaacgccaccggttacgacttccgccacttgttcatcggctcg
gaaggcaccttgggcttcgtcgtggaagccaccgtgaagctggcccgccagcccagaaat
ctgaccgccctggtgctgggcgtgcccggcttccaggaagtgatgaaggtattacacgcc
tttcagtccgaactggaccttaccgccttcgagttcttctccgacaaggccatggcccac
gtgttggcgcacggcgtctcccgtccctttgataccgattgcccgttttactgcctgctg
gaattcgagcaggtctccgaacaaaccgccgaccaggccatggcggtgttcgagcgctgt
gtggaacagggttgggtgctggatggcgtgatgagccagtcgctgcagcagttggatcag
ctgtggcagttgcgcgaacgcatttccgaatccatcgcgccgcacaccccgtacaagaac
gacatctcggtaaccatcgacaaggtgccggagttcgtcgaggcggtggacacggtggtc
caggacgcctatccggatttcgagatcgtctggttcggccacatcggcgacggcaacatg
cacctgaatatcctgaaaccggaggcgctgccgaaggaagatttcttcgagaaatgcaac
aacgtttccaagtgggtgtttgaaatcgtggaacgctacaacggctctatttccgcggaa
cacggtgtcggcatgaccaagaagccctacctgggctactcccgcagccccgaggaaatc
gcttatatgaaggcggtaaaacgggtcttcgatccgaataacgtgatgaacccgggcaag
ctgttcgacctctaa

DBGET integrated database retrieval system