KEGG   Alcanivorax dieselolei: B5T_00036Help
Entry
B5T_00036         CDS       T02259                                 

Definition
(GenBank) MerR, DNA binding family
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_1 MerR-DNA-bind MerR AbiEi_4 DUF1836 RuvA_C HTH_17
Motif
Other DBs
NCBI-ProteinID: AFT68325
UniProt: K0C772
Position
38311..38679
Genome map
AA seq 122 aa AA seqDB search
MRIAELEQRTGVSRHTLRYYEKQGLLREVDRRGNNYRDYPEPAVARVAMVRQLKGLGFSL
KEIREVLDALRDDRIDCAQGAALMAEKREAVERRMAELSEVRDLLAREQRKLEESAARSR
GT
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcgcggagctggaacaaagaaccggagtgagccgccacactctgcgttattac
gagaaacagggactgctgcgggaagtggaccgccgtggtaacaactaccgtgattacccg
gaaccggcagtggcgcgggtcgccatggtgaggcaactgaaagggctggggttctccctc
aaggaaatccgcgaggtattggacgcgctacgtgacgatcgtatcgactgtgcccaggga
gcggcgttgatggcggaaaaacgggaagccgtggagcggcgcatggccgagctgtccgag
gtgcgtgacttattggcgcgggagcagcggaagctggaggaaagtgccgcgcgatcacgc
ggcacctga

DBGET integrated database retrieval system