KEGG   Alcanivorax dieselolei: B5T_00060Help
Entry
B5T_00060         CDS       T02259                                 

Definition
(GenBank) Zn-dependent hydrolase of the beta-lactamase fold faimly
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3
Motif
Other DBs
NCBI-ProteinID: AFT68349
UniProt: K0C4T1
Position
complement(62946..63974)
Genome map
AA seq 342 aa AA seqDB search
MIDWSLLEQWARRDARPRGRFRNLYPTPDHGLAELLRWQRETRGRFPPHLPFPLQQPDPA
LLARPAPQPRFTWIGHSTYLIQYRNWNLLTDPVFSERCSPVSFAGPKRAVPPALTIDVLP
PIHAVLVSHNHYDHLDRAAVDALQRRFGDHITWFAPTGVGAWLRRRGITEVVERGWWQHA
GWHDAQAFCLPTQHFSGRGPRDRNTTLWCGWRLQWPDFSLFFAGDTGYAPLFQDIHKAVG
PVDTALLPIGAYLPRWFMAPVHINPEEAVRIHQDLQARHSLAMHWGTFVLTDEPMDEPPR
LLTQALAARGIPTGQFRVPAHGETVTLPLRDTVAAIDPVLPS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatcgactggtctctactggaacaatgggcgcggcgcgatgcccggcctcgcggacgt
ttccgcaatctttaccccacacccgatcacggactggcggagttgctgcgctggcaacgg
gaaacccgcggccgcttcccgccccatctgccattcccattacagcaaccagacccggcg
ctgctggcccggccggcaccgcagccgcgtttcacctggattggccacagcacctatctg
atccaataccggaactggaatctgctgaccgacccggtgttctccgaacgctgttcaccg
gtctccttcgccggccccaagcgcgccgttccgccggcgctgaccatcgatgtactgccg
cccatccacgcggtgctggtttcccataaccactatgatcacctggaccgggcggcggtg
gacgcgctgcaacgacgcttcggcgatcacatcacctggttcgcccccaccggggtcggc
gcctggctgcgccgccggggcatcaccgaagtagtcgagcggggctggtggcagcacgcg
ggctggcacgacgctcaggcgttctgtctgccgacccagcatttcagcggccgcggcccc
cgtgaccgtaataccaccctgtggtgcggctggcgcctgcagtggccggacttcagtttg
tttttcgccggcgataccggttacgccccgctgttccaggatatccacaaggcggtggga
ccggtggacacggcgctgttgccgatcggcgcctatctgccccgctggttcatggcgccg
gtgcatatcaatccggaggaggccgtgcgcattcaccaggatctgcaagcacgtcattcc
ctggccatgcactggggaaccttcgtactcaccgacgaaccaatggacgagccgccacga
ctgctcacccaggcccttgcagcccggggcattcccaccggacaattccgcgttccggcc
catggcgaaaccgtgactctgcccttgcgcgacaccgttgccgccattgaccctgttttg
ccgagctaa

DBGET integrated database retrieval system