KEGG   Alcanivorax dieselolei: B5T_00063Help
Entry
B5T_00063         CDS       T02259                                 

Gene name
chpA
Definition
(GenBank) CheA signal transduction histidine kinase
  KO
K02487  type IV pili sensor histidine kinase and response regulator
K06596  chemosensory pili system protein ChpA (sensor histidine kinase/response regulator)
Organism
adi  Alcanivorax dieselolei
Pathway
adi02020  Two-component system
Module
adi_M00507  ChpA-ChpB/PilGH (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:adi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B5T_00063 (chpA)
Protein kinases [BR:adi01001]
 Histidine kinases
  CheA family [OT]
   B5T_00063 (chpA)
Two-component system [BR:adi02022]
 CheA family
  ChpA-ChpB/PilGH [MD:M00507]
   B5T_00063 (chpA)
Bacterial motility proteins [BR:adi02035]
 Pilus system
  Twitching motility proteins
   B5T_00063 (chpA)
  Chemosensory pili system proteins
   B5T_00063 (chpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hpt Response_reg CheW HATPase_c H-kinase_dim
Motif
Other DBs
NCBI-ProteinID: AFT68352
UniProt: K0C9I5
Position
complement(65516..71707)
Genome map
AA seq 2063 aa AA seqDB search
MSDHHDYLALDWVRGEIQETLDQARQALEAYVENPGDSTRMRFCQTHLHQVHGTLQMVEF
YGAALLAEEMEKLARALLDQRIDREAESLELLMRAILQLPPYLDRVASNRRDLPVVLLPL
LNDLRAARGEPLLSETALFKPDLRHAQGDGRIDESIRNDARFPQLIRKMRQTFQVALVGV
MRGEQVKRNLGYLRRVLEKLRQISGEAARAPLWRIADAMVEGLEEEVIPLGSSAKQMLGQ
LDRTLRELAADGADSLERPAPTELIKNLLYYVARAERATPAIDAIRRRFRLQDALPPEAL
VNEERARLNGPDATAMHSVVTALSEEITKVKDHLERFVHDSRADPADLAPLVSTLKQVSD
TIAMLGLGQPRVLVDEQRQVLEDIAERRQPPQRERLMDVAGALLYVEATLAGFGGNNQHR
PAGNTVGNTVEGTDTSSLPNHLGQAMDAALRECRAGLEEAKDGVVEFIASHWDRAHLQSV
PDRLQAVRGGLEMVQLQRPALVLRQCARFIQERLLGDEQAPDWQSMDTLADAMSSVEYYL
ERLSDDPHTSDDVLEVAHRSIAALGYPLQPLESDAEPSSTATAAEPEPRNADDDDDLVDD
EIIEIFVEEADEVIEALDQYFPRWAADTGDETALVEFRRAFHTLKGSGRMVGATTVGELA
WAIENMMNRVIDHSISADATLIHLVREAHGLIPDLVGAFARRQPDPVDVTPLIEAAGILA
GGGSLDNLDGPTLPETSADQTDPVLLDIFRREADRNLTLLTQWLDGLDPELGEQDLDDRV
HRALHTLKGSARMAELDAMAEMAEAGEKLVKELIAAGLRANRDQVALIRDSHRQLSEGLR
RLASQGDAALPDAGPLLRALDDARHQVRGDHQNNNAQVLAMLLSDSMDLVMDADTLLQAW
ATDPEQIRPLARLRDELQNLAQGARKASLEEIEGLALALATAYATVTQGRLAFDPGLLAQ
LNEGHDALINMLDCLAAGQTVRAELGLVDGLRDLTETRQPLTLDPQAPSAPASEHSSGLL
QQAEEALLRANEHLATWQLGQPASLNQLDQELTELATSAGEAEVPALADLAASLAGLYRR
LASPETGAPTPSVFDILQRAHHRLADMIDQLRSGSLPATDTVLEDVLALADIPWTPMAKA
EVEAEGAPPEPAAQPAMEERDPELVGIFLEEAEDILHSCTESLERWIAEPENILLVQALQ
RDLHTLKGGARMAELSELGDLGHEMETLYERLALGRVERQPAVFDLLHRCHDRVAEMIDR
VTARQALASARDLIQAIHDYLNDPSGFRLAAPVSDVIPEAAPARPAAPPSGGGDSGGIDP
DILDIFLEESEELGETIEATLTAWRDQPEDRQLNDQLKRALHTLKGGARLAGVAPLGDLS
HDFEQFLERLDNQRRAPEEDDFLTMLGWLDAINQQRGQLRGQPADTRAPDLLPEPSATPE
PAAAMPAAPQEMVRVSAEVLEALVNLAGETSINRGRVEQSINDFVSHVSEIGATVTRLYE
QLRRLDAETEAQILSNYQQGVDRGEFDARFDPLEMDQYSELHQITKQLSESASDLLDLKN
TLLERTRDSETLLLQQQRINTELQEKLMRTRMVPFSRLVPRLRRIVRQVSGEVGKQVEFE
VINPEGELDRTLMERMVAPLEHMLRNAIDHGIESPRERREAGKNETGQVRLELTREGGEV
VLTLADDGGGINTGAVRAKAVERGLIDADANPSDKDVHQFIFHAGFSTASQVTQLSGRGV
GMDVVASEIKQLGGTVHIESRRGQGTRFVVRLPFTLAVNRALMVRANEDTYAIPLNQIEG
IVRVSPFELLDYVENQNLVYRYAGQDYDLHYLGRFVHDLPMPHPDVQSQPLPLLLIRSSD
HAVALVVDSLVGSREVVVKSLGPQLTSVAGISGATILGDGSVVVILDIHSLIRAAQLRQP
APLTAPADQRDAAREQAPLVMVVDDSVTVRKVTGRLLERQGYRVVTAKDGLDAIAKLEDH
TPDAMLLDIEMPRMDGFEVASHVRHDARLARVPIIMITSRTGEKHRDRAFDIGVNGYMGK
PFQEGELITTLGELLEESRESVG
NT seq 6192 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcatcacgattatctggctctcgactgggtgcgcggcgaaatccaggaaaca
ctggaccaggcccgccaagcgctcgaagcctatgtggagaacccgggcgactcaacacgc
atgcggttctgccagacccacctgcatcaggtccatggcaccttgcagatggtggagttc
tacggcgccgcgttgctcgccgaggaaatggaaaaactggcccgggccctgctcgatcag
cgtatcgaccgggaagcggaaagcctggaattgttgatgcgcgcgatcctgcagctgccc
ccttatctggatcgcgtggccagtaaccgccgggatttgccggtggtgctgctgccattg
ttgaacgacctgcgcgccgcacgcggtgaaccgctgctgtccgaaaccgcgctgttcaaa
cccgatctgcggcacgcccagggcgacggccgcattgatgagagcatccgcaacgacgcc
cgctttccgcagttgatccgcaaaatgcggcagacgttccaggtggcgctggtgggcgtc
atgcgcggcgagcaggtgaaacgcaacctcgggtatctgcgccgggtgttggaaaaactc
cggcaaatcagtggtgaagccgcccgggcgccattgtggcggatcgccgatgcgatggtg
gaggggctggaggaagaggtcattccgctgggctcttcggccaaacagatgctgggccag
ttggatcgcaccttgcgagagctggccgccgacggcgccgacagcctggaacggccagcc
cccacggagttgatcaagaacctgctgtattacgtggcccgggcggagcgcgcgacgccg
gccatcgatgccatccggcggcgctttcgtctgcaggacgcattacctcccgaggcattg
gtgaacgaggagcgggcccgcctcaacggcccggatgccacggccatgcattcggtggtg
accgccttgtccgaggagatcaccaaggtcaaggatcacctggagcggttcgttcacgac
tcccgggcggaccccgccgatctcgcgcccctggtcagcacgctgaagcaggtgtccgac
accatcgccatgctcggcctgggccagccccgggtactggtggatgaacaacggcaggtc
ctggaggacatcgccgaacgccgtcagccgccgcaacgggagcggctgatggatgtggcc
ggagccctgttgtacgtggaagccacgctggccggctttggcggcaacaaccagcaccgc
cccgccggcaataccgttggcaataccgttgaaggtaccgacacttcttcgctgcccaat
catctcggccaggccatggacgcagcgctgcgcgaatgccgggcggggctggaagaagcc
aaggacggggtggtggaattcatcgcctcgcattgggatcgtgcgcatttgcaatcggtg
ccggaccgcctgcaggccgtccgtggcggcctggagatggtgcaactgcaacgcccggct
ctggtgctgcggcagtgcgcccgttttattcaggaacggctgctgggcgacgaacaggcc
cccgactggcagagcatggataccctcgccgatgccatgagttcggtggagtattacctg
gaacgccttagcgacgatccgcataccagtgacgatgttctcgaagtggcccatcgcagc
atcgccgccctggggtatccgcttcagcctctggagagcgatgcggaaccgtcatcaacg
gcaacagcggcggagccggaaccgcgaaacgcggacgacgatgatgatctggtggatgac
gaaatcatcgagatcttcgtcgaggaggcggacgaggtcatcgaggcactggaccagtac
tttccccgctgggccgccgataccggcgatgaaaccgctctggtggagtttcgccgcgcc
tttcacacgttgaagggctccggccgcatggtcggtgccaccaccgtgggcgaactggcc
tgggccatcgagaacatgatgaaccgggtcatcgaccacagcatcagcgccgacgccacg
ctgatccacctggtacgcgaagcccacggcctgatccccgatctggtcggcgctttcgcc
cgccgccaaccggacccggtggacgtgaccccgctgatcgaagccgccggcatccttgct
ggcggcggcagcctggataacctggacggtccaacgttgccggaaacatccgcggatcag
accgacccggtgctgctggatattttccgccgcgaggccgaccgcaatctcacgctgctg
acgcaatggctggatgggctggacccggaactcggcgagcaggatctggacgatcgcgtc
catcgcgccctgcacactctgaagggcagcgcgcgcatggccgaattggatgccatggcg
gaaatggcggaggccggtgaaaaactggtgaaggaattgattgccgccggcctgcgcgcc
aaccgcgatcaggtggcgctgatccgcgacagccaccggcaactgagcgaaggcctgcgg
cgattggcctcccagggcgatgccgctttacccgatgccggaccgctgttgcgtgccctg
gacgacgcccgccaccaggtgcgtggagaccatcaaaacaataacgcccaggttctggcc
atgctgctgtccgacagcatggacctggtgatggacgccgataccctgctacaggcctgg
gccaccgatcccgagcagatccggccgttggcccggctccgcgatgaactgcagaacctg
gcgcaaggtgcccgcaaggcgagtctggaggaaatcgaagggctcgccctggccctggcc
accgcctacgccaccgtcactcagggacgcctggccttcgaccctgggctgctggcacag
ctcaatgaaggtcatgacgcgctgatcaatatgctcgattgtctggccgctggccagacc
gtgcgcgccgaattggggctggtggatggcctgcgcgacctgaccgaaacccggcagccg
ctgacgctggacccgcaagcgccatccgcacccgcctcggagcatagcagtggactttta
cagcaggccgaggaggccttgctgcgcgccaacgaacatcttgccacctggcaattgggg
caaccggccagcctcaatcagctcgaccaggaacttaccgagctggccaccagcgccggc
gaggcggaagtccccgccctggcggacctggccgcctccctggccgggttgtaccgccgt
ctggcatcaccggagaccggcgcgccaacgccctcggtgttcgatattctgcaacgggcc
catcatcgactggctgacatgatcgatcagctgcgctccggctcactgccggccacggac
accgtcctcgaggatgtactggcactggccgacataccctggaccccgatggcgaaggcg
gaggtggaggcggagggcgcgccaccggaaccggcggctcagccagccatggaggaaagg
gatccggaattggtcggcatctttctggaagaggccgaggacattctccacagttgcacc
gaaagcctggaacggtggattgcggaaccggagaacatcctgctggtgcaggccctgcag
cgggacctgcacaccctgaaaggcggggcgcgcatggccgagctcagcgagctgggtgat
ctgggccatgagatggaaacgctctacgagcgcctcgctcttggccgggtggagcgacag
ccggcggttttcgatctgctgcaccgctgccacgaccgcgtggcggaaatgatcgaccgg
gtcaccgcccggcaggcccttgcctctgcccgggatttgattcaggccatccatgactac
ctgaacgatccatccggtttcagactcgcggctcccgtctccgacgtcattcccgaagcc
gccccggccagacctgccgcgccgccgtccggcggcggtgatagcggcggcatcgatccc
gacattctcgatatttttctggaggaatcggaggaactgggcgagaccattgaagcgacc
ctgaccgcctggcgggatcaaccggaggaccgtcagctcaacgaccagctcaaacgggcg
ctgcacaccctcaagggcggcgctcggctggcgggggtggcacccctcggggatctgagc
catgacttcgagcaatttctggagcggctggacaatcaacgccgggccccggaagaagac
gacttcctcaccatgctcggctggctggacgcgattaaccagcaacgcgggcagctgcgc
gggcagccggcggacacccgggcaccggacctccttccggaacccagcgccactcccgag
ccggctgccgccatgccggcggcaccacaggaaatggtacgggtgagcgccgaggtgctc
gaggcgctggtgaacctggccggggaaacctccatcaaccggggccgggtggaacaaagc
atcaacgatttcgtctcccatgtgtcggagatcggcgccaccgtcacccgcttgtatgaa
caactgcgccggctggacgcggaaaccgaagcgcagatcctctccaattatcagcagggc
gtggaccggggcgagttcgacgcccgcttcgaccccctggagatggaccagtattccgaa
ctgcaccagatcaccaagcagctttccgagtccgcctcggacttgctggatctgaaaaac
accttgctggaacgaacccgcgacagcgaaacgctgttgctgcagcagcagcgtatcaat
accgagctgcaggagaagttgatgcgcacacgcatggtgccgttctcccggctggtgccg
cgcctgcgccgcatcgtccgccaggtttccggcgaggttggcaagcaggtcgagttcgag
gtgatcaacccggaaggcgagttggatcgcaccttgatggaacgcatggtggcgccgctg
gagcacatgctgcgcaacgccatcgaccatggcatcgagtcgccccgggagcggcgcgaa
gccggcaagaatgagaccggccaggtgcgcctggaactgacccgcgagggcggcgaggtg
gtgctgacgctggccgacgacggcggcggtatcaataccggggcggtacgcgccaaggcg
gtggagcgggggttgatcgatgccgatgccaaccccagcgacaaggacgtgcatcagttc
atcttccacgccggcttctccaccgccagccaggtcacccagctgtcgggccggggcgtc
ggcatggatgtggtggccagtgaaatcaaacagctcggcggcaccgtgcacatcgagtcg
cgccgcgggcagggcacccgtttcgtggtgcgtctgccgttcaccctggcggtgaatcgg
gccttgatggtgcgcgccaacgaggacacctacgccattccgctcaaccagatcgaaggc
atcgtgcgggtcagtccgttcgaattgctcgattatgtggagaatcagaacctggtgtat
cgctacgccggtcaggactacgacctgcattacctgggccgtttcgtacatgatctgccg
atgccgcatccggatgtgcaaagccagccgttgccgttgctgttgatccgcagttccgac
cacgccgtggccctggtggtggacagcctggtgggctcccgcgaggtggtggtgaaatcc
ctcgggccgcagctcaccagcgtggccggcatcagcggcgccaccatcctcggcgacggc
tcggtggtggtgatcctcgacatccactccctgatccgcgccgcccagctgcgccagcca
gcaccgctgaccgccccggcggaccagcgcgatgccgctcgcgagcaggcaccgctggtg
atggtggtggacgattcggtgacggtgcggaaagtcaccggacgcctgctggagcgtcag
ggctatcgcgtggtcaccgccaaggacggtctggacgccatcgccaagctggaggatcac
acgccggatgccatgctcctggacatcgaaatgccacgcatggacggcttcgaggtggcg
tcccatgtccgccatgatgcgcggctggcgcgggtgcccatcatcatgatcacctcgaga
accggcgagaagcaccgtgaccgggccttcgatattggcgtcaacggctacatggggaaa
ccgttccaggaaggcgaattgatcaccacgctcggcgagttgctggaggaaagccgggag
agcgtgggatga

DBGET integrated database retrieval system