KEGG   Alcanivorax dieselolei: B5T_00071Help
Entry
B5T_00071         CDS       T02259                                 

Gene name
algH
Definition
(GenBank) UPF0301 protein
  KO
K07735  
putative transcriptional regulator
Organism
adi  Alcanivorax dieselolei
Brite
Transcription factors [BR:adi03000]
 Prokaryotic Type
  Other transcription factors
   Others
    B5T_00071 (algH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
78352..78915
Genome map
AA seq 187 aa AA seqDB search
MTHNSLKHQFLIAMPQLDDPNFDRTVTYVVEHNPEGAMGLTLNRPAGLSLHDILADMEIE
VEVPPSSRHQVVAGGPIQQEAGFVLHRDVERHWQSTLMLADGLCMTTSRDILEAIAVGEG
PESTLVCLGYAGWSEGQLEQELADNVWLSTPSAPELVFEIPFEQRWHAAAARMGVDMSLI
TTQVGHG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacaacagcctgaaacaccagttcctgatcgccatgccgcagctggatgatccc
aacttcgaccgcaccgtgacctatgtggtggagcacaatccggaaggggccatggggctg
accctgaaccgtccggccggcttgagcctgcacgatattctggcggatatggagatcgag
gtggaggtgccgccctccagccgccatcaggtggtggccggcggcccgatccagcaggaa
gccgggttcgtgttgcaccgggatgtggagcgccactggcagtccaccctgatgctggcg
gatgggctgtgcatgaccacctcacgggacattctcgaggccatcgccgtgggcgaggga
ccggaatccaccctggtgtgcctggggtatgccggttggagcgaaggccagttggagcag
gaactggcggataatgtctggctgagcacccccagcgccccggagttggtgttcgagatc
ccgtttgaacagcgctggcatgccgcggccgcccgcatgggcgtggatatgagcctgatc
accactcaggtgggccacggttga

DBGET integrated database retrieval system