KEGG   Alcanivorax dieselolei: B5T_00073Help
Entry
B5T_00073         CDS       T02259                                 

Definition
(GenBank) hypothetical protein
Organism
adi  Alcanivorax dieselolei
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
79395..80765
Genome map
AA seq 456 aa AA seqDB search
MAKIQQPPDFSKVFKEKTSAVVAAMSHYGAVDAKGRYMHWHDLRRRLPAAEDKEAAWAAI
KLARSGLLKSLPLKAEDGRSFQFCTIDAAESVLHRIDRLCAPALKEGGLELSNQSEREQY
LVETLMMDEAISSAQLEGAATTRQIARDMLIRERRPRNEDERMIFNNYLLMKEAKRASEE
LLSLELIFRFHELATSGTLQDGVVPGEPRQTDDIVVVDRDGDVVHRPPTAEALLGRLKAL
CRFANATHDGRDGRAFIHPAVKAVILHFMVGYEHPFADGNGRTARAVFYWYMLKAGYWPF
EYISISSLLKEAPIQYGEAYLFSETDGLDLTYFIVYQLAVIQRAIDTFLEYVETKRREYL
ELIAWLTEIGIGDRLNYRQGQLLRQALKNPGTSFTAKEVKNLFDVSENTARSDLQRLEKM
QILAPYKVGKTMEFLARADAAERLKAELGRSRRRRS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaattcagcaaccacctgatttcagtaaggtttttaaagagaaaacaagtgcc
gtggttgccgccatgtcccattatggagcagtggacgcaaaagggcgctacatgcactgg
catgatctgcggcgccgtttgccggccgccgaggataaggaggccgcctgggctgcgatt
aaactggcccggtccggattgctcaaatctttgccactgaaagccgaggacggccgttct
ttccagttctgcaccattgacgccgccgaaagtgtgctgcatcgcattgatcgtctgtgc
gctccggccttgaaggagggtgggctggaactctccaaccaaagtgaacgggagcagtat
ctggtcgagaccctgatgatggatgaggcgatctccagtgcgcagttggagggggccgcc
accactcgtcagattgcccgggacatgctcatccgcgagcgccgcccccgtaacgaagac
gagaggatgatcttcaataactatctgttgatgaaggaggcaaagagggccagtgaagaa
ctgctgtctctggaactgattttccgtttccacgagctggccacctcggggactctccag
gatggagtagtgcctggagagccgcgtcagaccgatgacatcgtggtggttgaccgggat
ggcgatgtcgtccacaggccgccgaccgccgaggctctgctggggcgtttgaaagccttg
tgccgtttcgccaatgcaacccacgatggccgggatgggagagcttttatccatcccgcg
gtaaaagcggtgattctgcatttcatggtggggtatgagcacccgttcgcggacggcaat
ggccggaccgcacgggcggtgttttactggtacatgttgaaagccgggtactggccattt
gagtacatatcaatcagcagtctgttgaaagaggctccgattcaatatggcgaggcctac
ctgttctcggaaaccgacggcctggatctgacctatttcattgtttaccagttggcggtg
attcagcgcgccattgatacctttctggagtatgtggaaacgaagcggcgggagtatctg
gagctgatcgcctggttaacggaaatcggtatcggtgatcggttgaattaccgtcagggg
cagcttttgcgccaggcgctgaaaaatccgggaaccagcttcaccgccaaggaagtgaag
aatttgttcgacgtgtccgagaatacggcgcgctcggatctgcaacggttggagaagatg
cagattctggcaccttacaaggtggggaaaaccatggagtttctggcgcgggctgacgcg
gcggagcgcctcaaggcggagctgggaagaagccgccggcgacgctcataa

DBGET integrated database retrieval system