KEGG   Alcanivorax dieselolei: B5T_00167Help
Entry
B5T_00167         CDS       T02259                                 

Gene name
gmk-2
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00230  Purine metabolism
adi01100  Metabolic pathways
Module
adi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    B5T_00167 (gmk-2)
Enzymes [BR:adi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     B5T_00167 (gmk-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_22 MobB MMR_HSR1 AAA_26 cobW AAA
Motif
Other DBs
NCBI-ProteinID: AFT68455
UniProt: K0C7I3
Position
complement(181293..181925)
Genome map
AA seq 210 aa AA seqDB search
MADIGTLYIVSAPSGAGKTSLVAALVEKLPRLRISISHTTRDRRDGETDGVNYHFIKRES
FVRLVEQGRFLEHAEVFGNLYGTSADWVSGTLRNGEDVILEIDWQGAAQVRRQMPEAISI
FILPPCLKTLEQRLRSRASDDDEVIRKRLAGAREEMSHYGEFDYLVVNDNFERALHELAA
IVEARRLTTHRQAVRQAAVLADLLSDSETR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggccgacattggcaccctgtacatcgtttccgcaccttccggcgccggcaagacttct
ctggtggcggcactggtggaaaagctgccgcgtctgaggatttccatttcccacaccacc
cgcgaccgccgcgacggcgaaaccgatggtgtgaactaccacttcatcaaacgcgaatcg
ttcgtaaggctggtggagcagggccggttcctggaacacgccgaagtgttcggcaacctc
tatggcaccagcgccgactgggtttccggcaccctgcgtaacggcgaagacgtgattctg
gagatcgactggcagggcgccgcccaggtccgccggcaaatgcccgaggcgatcagcatc
ttcattctgccgccgtgcctgaagaccctggagcagcgcctgcgcagccgcgcttccgat
gacgacgaggtgatccgcaagcgcctggccggggcccgggaggagatgagccactatggc
gaattcgattatctggtggtcaacgataacttcgaacgcgccctgcatgaactggccgcc
atcgtcgaagcccgccgtctgaccacccatcgccaggcggtgcgtcaggcggcggtactg
gcggacttgttgtccgatagcgaaacccggtaa

DBGET integrated database retrieval system