KEGG   Alcanivorax dieselolei: B5T_00469Help
Entry
B5T_00469         CDS       T02259                                 

Gene name
folA
Definition
protein containing dihydrofolate reductase region domain
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
adi  Alcanivorax dieselolei
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:adi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:adi00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
483038..483565
Genome map
AA seq 175 aa AA seqDB search
MNDSNEQGVRVAMIVAMARNRVIGRDNKLPWYLPNDLKYFKRTTLGKPVVMGRLTWESLG
RPLPGRTNIVISRDPHYQAEGAKVVADLDQALELAGNVAFIDGQDEVMILGGAQIYALAL
PRADRLYITEVQADVDGDAWFPRWDRSQWVERGRESFKAEGPNPYDYDFVVFDRC
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacagcaacgaacaaggcgtgcgagtggcgatgatcgtggccatggcccgtaat
cgggtgatcggccgcgacaacaagctgccctggtatctgcccaacgatctcaagtacttc
aagcgcaccactttgggaaaaccggtggtgatggggcggctgacctgggagtccctgggg
cggccgttgccgggccgcaccaacatcgtcatcagccgggatccgcactaccaggccgag
ggcgctaaagtggtggcggatctggatcaggctttggaactggcggggaacgtggcgttc
atcgacggtcaggatgaagtgatgatcctgggcggcgcgcagatctatgccctggcgctg
ccgcgggcggaccggctctatatcaccgaagtgcaggcggatgtggatggggatgcctgg
ttcccgcggtgggaccggtcgcagtgggtggagcggggccgggaatccttcaaggcggaa
ggcccgaacccgtacgattacgatttcgtggttttcgaccgttgctga

DBGET integrated database retrieval system