KEGG   Alcanivorax dieselolei: B5T_00783Help
Entry
B5T_00783         CDS       T02259                                 

Definition
alkaline phosphatase lipoprotein transmembrane
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
adi  Alcanivorax dieselolei
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:adi00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:adi00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:adi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
831772..833232
Genome map
AA seq 486 aa AA seqDB search
MTMRQEVLMKMLKMAGLALAVTLAGCGSDSDNHDAPPPAAAKKNVLFFLGDGMGITTLTA
MRIFEAGEAGSITIDTLPETAFVRTYSADGQVTDSAPSMAAYMTGVKMKNEVISMSTGTN
AYAPDGSQYVDADGNSTCEEGNGASVETLLELMKGQGFATGVVTTTRVTHATPATTYAHI
CNRNGENTIAAQMVPGGDGFNAALGDGVDVMLGGGRRHFLPADQSGRRTDGRNLIEEMQT
AGYQYVDNTDALMGVADDTEKLLGIFTSSDMSYELDRIPTQEPSLAEMTGKAIDLLSPRD
NGFFLMVEGGRIDHALHATSAKRALTDGIAFDNAVKTALEKMEAIDPGLENTLIVVTADH
DHTLVINGYAERTGKTTEDHAGVLGMVRNYANGPNKGVPRTDVDGNPYTILGFGNGPNRP
ATRVALTETETAADDYLQEAVIQLSSETHGGGDVFLGAVGMGADVFHGVIDNTEVFGKIK
AALDLD
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgagacaggaagtgctgatgaaaatgctcaaaatggcggggctcgcccttgcc
gtaacgctggccggctgcggcagtgacagcgacaaccacgatgcgccaccgccagccgcc
gccaagaaaaacgtactgttcttcctcggtgatggcatgggtatcacgacgttgaccgcc
atgcgtatcttcgaggccggtgaagcgggaagcatcaccatcgatacgctgccggaaacc
gcttttgtccgtacctactccgcggatggtcaggtgaccgatagcgctccctccatggcc
gcttacatgaccggcgtgaagatgaaaaatgaagtcatctccatgagcaccggcaccaac
gcctacgcgccggacggttcccagtatgtggatgccgacggcaacagcacctgtgaggaa
ggtaacggcgcctcagttgagacgctgctggagctgatgaaggggcaaggctttgccacc
ggcgtggtcactaccacccgcgtgactcacgccactccggcaacgacctacgcccacatc
tgtaaccgtaacggtgaaaacaccatcgccgcgcagatggtgccgggcggggacggcttc
aacgccgcccttggtgacggtgtcgacgtcatgctcggtggcggccgccgtcacttcctg
cccgcggatcagagtggccgccgtaccgacggtcgtaacctgatcgaggaaatgcaaacc
gccggctatcagtacgtggataacaccgacgctttgatgggcgtggccgacgacaccgaa
aagctgcttggcattttcaccagcagcgatatgagctacgagctcgaccgtattcccacg
caagagccgagcctggccgaaatgaccggcaaagccatcgatttgctcagccctcgcgac
aatggcttcttcctgatggtggaaggcggtcgtattgaccatgcgctgcacgctaccagt
gccaagcgtgctctgaccgacggtatcgcgttcgataacgcggtgaaaaccgcgctggaa
aaaatggaagcgatcgatccgggtctggaaaataccctgatcgtggtcaccgcggaccac
gaccacactctggtgatcaatggctacgccgagcgtactggcaagaccacggaggaccac
gccggtgttctgggtatggtgcgtaactatgccaacggcccgaacaaaggggtgccgcgc
accgatgttgatggcaacccgtacaccattctcggcttcggtaacggcccgaatcgcccc
gccacccgtgtcgcgttgacggagacggaaaccgccgcggacgactatctgcaggaagca
gtcattcagctcagcagtgaaacccacggcggtggtgatgtgttcctgggagcggtcggc
atgggtgccgacgtcttccacggtgtcatcgacaacaccgaagttttcggcaagatcaag
gccgccctggatctggattga

DBGET integrated database retrieval system