KEGG   Alcanivorax dieselolei: B5T_00784Help
Entry
B5T_00784         CDS       T02259                                 

Definition
alkaline phosphatase protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
adi  Alcanivorax dieselolei
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B5T_00784
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B5T_00784
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B5T_00784
Enzymes [BR:adi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     B5T_00784
Exosome [BR:adi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B5T_00784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
833259..834665
Genome map
AA seq 468 aa AA seqDB search
MKRSVIGGALICCAATLMTQPVNAAQAKNIIFFLGDGMGPVTQTAARIYAGEKAGLEVPE
THKLAMEQLDYAARIKTYSEDAQTTDSAPGMASYMTGMKSKNEVISMTPDTNPNDGDGNP
YQTNGDSLCPETGNGEAARTLLEILKAEGYSTGVVTTTRITHATPATTYAHICNRNAENT
IATQMVPGGEGYNSALGNDGIDVILGGGRRHFLPAPDGRRSDDRDLIMEMQGAGYTYVSS
GSELGAVDLGNTEKLFGLFNSSDLNYELDRVNNELDEPSLAEMTRSAIDILSRNQDGYFL
MVEGGRIDHALHGTNAKRALEDTLAFDQAIAAAMEKADLENTLIIVTADHDHVMAFNGYS
KIGNPVLGLLKEYRTGGLALDAQGKPFTTLVFGNGGGPREADRATLTEDEVLQDDYLQEV
GVKLGGPGSETHGGGDVRLNAGGAGSDLFKGTLDNVDVFGLIHEAMGL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttccgttattggcggtgcactgatctgctgtgccgccactctgatgacccaa
ccggtcaacgccgctcaggccaagaacattattttcttcctcggcgacggcatgggcccg
gtaacacagaccgcggcgcgcatttacgccggtgaaaaagccggtctggaagtgccggag
acccacaagctggcgatggaacagctggattacgccgcgcgtatcaagacctactccgag
gacgcccagaccaccgacagcgcaccggggatggccagctacatgactggcatgaaatcc
aagaacgaagtgatttcaatgacaccggacaccaaccccaacgatggtgatggtaatccg
taccagaccaatggcgacagcctctgcccggaaaccggtaacggcgaggcggcgcggact
ctgctggagatcctcaaagccgagggctacagcaccggcgtggtgaccaccacgcgtatc
acccacgccacgcccgctactacctacgcccacatctgcaaccgcaatgctgaaaatacc
attgccacgcagatggtgccgggcggtgagggctataacagcgcgctggggaacgacggt
atcgatgtgatcctgggcggtggccgccgtcacttcctgccggcccctgacggacgccgc
agtgatgaccgcgacctgatcatggaaatgcagggcgccggttatacctacgtgagcagt
ggctccgagctgggggctgtcgacctgggcaatacggaaaaactgttcggtctgttcaat
agcagcgatctgaactacgagctggatcgggtcaataacgagctggatgagccgagtctg
gcggagatgacccgttccgccatcgatatcctgtcccgcaatcaggacggctacttcctg
atggtggagggcggccgtatcgaccacgcgctgcacggcaccaatgccaagcgcgcactg
gaagacacgctggccttcgaccaggccattgccgctgctatggaaaaagcggatctggaa
aataccctgatcatcgttaccgcggatcacgatcacgtcatggcgttcaacggctactcc
aagatcggtaacccggtactcggcctgttgaaggaataccgcactggcgggctggcgctc
gacgctcagggcaagcccttcactactctggtgttcggtaatggcggcggcccccgtgaa
gcggatcgggccacgttgaccgaggacgaagtgctgcaggacgattacctgcaggaagtg
ggcgtgaaactgggcggaccgggcagtgaaactcacggtggcggtgatgttcgcctgaac
gcgggtggtgccggcagcgatctgttcaaaggtaccctggataacgtggacgtgtttggt
ttgatccacgaagccatggggctttaa

DBGET integrated database retrieval system