KEGG   Alcanivorax dieselolei: B5T_00921Help
Entry
B5T_00921         CDS       T02259                                 

Gene name
pldA
Definition
phospholipase A1 superfamily
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
adi  Alcanivorax dieselolei
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    B5T_00921 (pldA)
   00565 Ether lipid metabolism
    B5T_00921 (pldA)
   00590 Arachidonic acid metabolism
    B5T_00921 (pldA)
   00591 Linoleic acid metabolism
    B5T_00921 (pldA)
   00592 alpha-Linolenic acid metabolism
    B5T_00921 (pldA)
Enzymes [BR:adi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     B5T_00921 (pldA)
    3.1.1.32  phospholipase A1
     B5T_00921 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(984185..985198)
Genome map
AA seq 337 aa AA seqDB search
MKRILLVCLLCGPLLALAQESTEATEAAAREAEAKRNECLLRGVQQGDRSVTLEELRRWC
DPQQQQRSAHEDALRGRLALERSSLNNPFALTPHRRNYLMPYSYWSNPQWNDPDREDDDL
DSKEIKFQLSLKAPLYDDFWDGSTLYMAFTGTFFWQAYNSNQSSPFREINYAPEIFLAKP
MDWKLGPVRTELMSFGFIHESNGRDVPASRSWNRIYVRHVSQIGSYYVSMMPWYRIPEDK
KKDPLQTSGDDNPDIEKYLGHFQLEVARPFGNHVLELMVRNNLRSDNKGAGEISYSFPIN
KRFKGLVQVFTGYGDSLINYDDYENRFSLGILLTDTL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcattttgctggtttgtctgctgtgtggcccgctgttggccctggcgcaggaa
agcacggaagccaccgaggccgccgcccgggaggcggaagcgaaacgcaatgaatgcttg
ttgcgtggtgttcaacaaggtgaccgttccgtcaccctggaagaactgcgccgctggtgc
gatccacagcagcagcaacgcagtgcccacgaggatgctctgcgcggccggctggccctg
gaacgctcttccctgaacaacccctttgccctcacgccccatcgccgcaattacctgatg
ccctattcctattggtcgaatccccagtggaacgacccggaccgggaagacgacgacctg
gactccaaggaaatcaaattccagctgtccctgaaggcaccactgtacgacgatttctgg
gacggcagcacgctgtacatggccttcaccggcacctttttctggcaggcctacaacagc
aatcaatccagtccgttccgggaaatcaactacgcgccggagatctttctggccaaaccg
atggactggaaactgggaccggtacgcaccgagttgatgtcgtttggtttcattcatgaa
tccaacggccgcgatgtgcccgcgtcccgtagctggaaccgcatttatgtacggcatgtt
tcccagatcggttcctactacgtctcgatgatgccctggtaccggattcccgaagacaag
aaaaaggatccgctgcaaaccagcggtgacgacaatccggacatcgaaaaatacctggga
catttccaactggaagtggcgcggccgttcggcaaccacgtgctggaattgatggtgcgc
aacaacctgcgctccgacaataaaggcgccggcgaaatttcctactctttcccgatcaac
aagcgcttcaagggactggtgcaggtgttcaccggctatggggattcattgatcaactac
gacgactacgagaaccgtttcagcctcggtattttgctgaccgacacgctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system