KEGG   Alcanivorax dieselolei: B5T_01043Help
Entry
B5T_01043         CDS       T02259                                 

Gene name
pfkA
Definition
phosphofructokinase domain-containing protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
adi  Alcanivorax dieselolei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B5T_01043 (pfkA)
   01230 Biosynthesis of amino acids
    B5T_01043 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B5T_01043 (pfkA)
   00030 Pentose phosphate pathway
    B5T_01043 (pfkA)
   00051 Fructose and mannose metabolism
    B5T_01043 (pfkA)
   00052 Galactose metabolism
    B5T_01043 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    B5T_01043 (pfkA)
Enzymes [BR:adi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B5T_01043 (pfkA)
Protein phosphatases and associated proteins [BR:adi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B5T_01043 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1130511..1131773)
Genome map
AA seq 420 aa AA seqDB search
MGSRNAFYAQSGGVTAVINASAAGVIETARAHKDVIGKVYAGRNGIIGALTEDLIDTSKE
SKSAIAALKHTPGGAFGSCRYKLKDLKTSQREYERLIEVFKAHDIGYFFYNGGGDSADTC
LKISQLSKTMGYPIQAIHVPKTVDNDLPITDVSPGFGSVAKYTAVSCREAALDVASMCAT
STKVFVMEVMGRHAGWIAAAAGLAKEQNEDAPHLILFPEIAFDQQAFLKKVDETVKKVGY
CVIVVSEGARTADGTFLADAGTTDAFGHKQLGGVAPVLAQMVKNELGYKYHWAVSDYLQR
AARHIASATDVEQAYAVGRAAVEFAVAGKNAVMPTIERKKTKKYGWTIGEAPLKKVANVE
KKMPRKFITKDGFGITPSARDYLAPLIEGESYPPYKNGLPQFAKLKLAAVAKKLNDQFEV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggggtccagaaacgccttttacgcacagtccggcggggttaccgccgtgatcaatgcc
tccgcggcgggagtgatcgaaaccgcccgtgcccacaaggacgtgatcggcaaagtctat
gccggtcgtaacggcatcatcggtgccctcaccgaggatctgatcgacaccagcaaggaa
agcaaaagcgccatcgccgcgctcaagcacacccccggcggcgccttcggttcctgtcgc
tacaagctgaaggatctgaaaacctcccagcgcgaatacgagcgtctgatcgaggtgttc
aaggcccacgacatcggctacttcttctataacggcggtggtgactccgccgatacctgt
ctgaagatttcgcagctgtccaagaccatggggtatccgatccaggcgattcacgtaccg
aaaaccgtggacaacgacctgccgatcaccgacgtcagcccgggcttcggctccgtcgcc
aaatacaccgcggtgagctgccgcgaggcggccctggacgtggccagcatgtgcgccacc
tccaccaaggtattcgtgatggaagtgatgggccgccacgccggctggatcgccgccgcc
gccggtctcgccaaggaacagaacgaggatgcgccgcatctgatcctgttcccggaaatc
gccttcgatcagcaggcgttcctgaagaaagtggacgagacggtgaagaaggtgggctac
tgcgtcatcgtcgtctcggaaggggcccgcaccgccgacggcaccttcctggccgatgcc
ggcaccaccgatgccttcggccacaaacaactgggtggcgtggcgccggtactggcgcag
atggtgaagaacgagctgggctacaaataccactgggcggtcagtgattatctgcaacgg
gcggcgcgtcatatcgcctccgccaccgatgtggagcaggcctacgcggtgggccgcgcg
gcggtggaattcgccgtggccggcaagaacgccgtgatgcccaccatcgagcgcaagaaa
accaagaagtacggctggaccatcggtgaggcgccgctgaagaaggtggccaacgtggaa
aagaagatgccgcgtaaattcatcaccaaggacggtttcggcatcaccccctccgcccgc
gactatctggcgccgctgatcgaaggcgagtcctacccgccgtacaagaacggcctgccg
caattcgccaaactgaaactggccgcggtggcaaaaaagctgaacgatcagttcgaggta
taa

DBGET integrated database retrieval system