KEGG   Alcanivorax dieselolei: B5T_01291Help
Entry
B5T_01291         CDS       T02259                                 

Definition
fatty acid desaturase protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
adi  Alcanivorax dieselolei
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    B5T_01291
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    B5T_01291
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     B5T_01291
Lipid biosynthesis proteins [BR:adi01004]
 Desaturase
  First
   B5T_01291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1384523..1385296
Genome map
AA seq 257 aa AA seqDB search
MHRRLIHNAYECPLWLEYLFVHFGVLVGMAGPLGMMHQHDLRDWAQRQPDCHPYLRHGEG
LWKDGWWQLHCDLALCEPPEFDPEPRVANDRVYAFMERTWMWQQLPWAVLLFWVGGLPWV
VWGISARIAVSVTGHWLVGYFAHNRGQRDWHVEGAAVQGFNIPAAAYLTMGESWHNNHHA
YPGSALLGLYENQPDPGWWVLNRLRDLGLVWSIRLPEDLPSRPELSALTATDCTERRRHL
PLSRSPNRSSHHENGRQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgccggctgatccacaatgcctatgaatgtccgctttggctggaatacctcttt
gtccacttcggcgtgctggtcggtatggccggcccactggggatgatgcatcaacacgat
ctgcgcgactgggcgcaaagacagccggattgccatccctacctgcggcacggagaaggc
ctttggaaggatggctggtggcagctccattgtgatctggcgctatgcgagccgccggag
tttgatccggagccgcgagtcgccaatgatcgtgtctacgctttcatggagcgaacctgg
atgtggcagcagctgccttgggctgtgctgctgttctgggtagggggattgccctgggtg
gtttgggggatttccgcgcgaattgccgtctcggtaacgggacattggctggtgggttat
ttcgcccataatcgtggacagcgcgactggcatgttgaaggcgcggcggtacagggcttc
aatattcccgccgcggcttatctgaccatgggagaaagctggcataacaatcatcacgct
tatccggggtcggcgttgctgggattgtatgagaatcaaccggacccgggttggtgggtg
ttgaatcgcctgcgggatctcgggctggtatggtcgatccgattgccggaagacttgccc
agcaggccggaactaagcgctttgacagcgacggattgcacggaaagaaggcggcacctg
cccttgtcgcgctctccgaacaggagttcccaccatgaaaatggtcgtcaataa

DBGET integrated database retrieval system