KEGG   Alcanivorax dieselolei: B5T_01392Help
Entry
B5T_01392         CDS       T02259                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
adi  Alcanivorax dieselolei
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    B5T_01392
  Carbohydrate metabolism
   00640 Propanoate metabolism
    B5T_01392
   00650 Butanoate metabolism
    B5T_01392
  Lipid metabolism
   00071 Fatty acid degradation
    B5T_01392
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B5T_01392
   00310 Lysine degradation
    B5T_01392
   00360 Phenylalanine metabolism
    B5T_01392
   00380 Tryptophan metabolism
    B5T_01392
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B5T_01392
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    B5T_01392
   00281 Geraniol degradation
    B5T_01392
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B5T_01392
   00627 Aminobenzoate degradation
    B5T_01392
   00930 Caprolactam degradation
    B5T_01392
Enzymes [BR:adi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     B5T_01392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1481045..1481833
Genome map
AA seq 262 aa AA seqDB search
MSASPVLVRTDGAIRTITINRPDKRNAVDRPTATALRLAFEAFERDDTVKVAVLAGEGGN
FCAGADLSALGDEERRNEMEAEGTGPGPMGPSRMLLSKPVIAAVSGYAVAGGLELALFCD
LRVAEASAVFGVFCRRWGVPLVDGGTVRLARIIGQGQALDMILTGRPVQADEALRMGLAN
RVVADGDALAEAQALAREIAAFPQRCLRADRLSTYQQWDHDLTEALRREGAGGYPVVFAE
ALAGAARFAKGAGRHGRFDDHG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctcacccgtccttgtccgcaccgacggtgcgattcgtaccatcacgattaac
cgccctgataagcgcaacgccgtggaccgccccaccgccaccgccctgcggctggctttt
gaagcgttcgaacgggatgacaccgtcaaagtggcggtactggccggcgaaggcgggaac
ttctgcgccggcgcggacctttccgccttgggcgatgaagagcgccgcaacgagatggag
gcggaaggcactggtcccggccccatggggccgtcccgcatgctgttgagcaagccggtg
atcgcggcggtatccggctacgccgtggccggggggctcgaactggccctgttttgcgat
ctgagggtggcggaggcgtcggcggtgttcggcgtgttctgccgccgctggggggtgccc
ctggtggacggtggcaccgtgcggctggctcgcatcattggtcaggggcaggccctggac
atgattctcaccggccgtccggtgcaggccgacgaggcattgcgcatggggttggccaac
cgggtggtggcggacggcgacgccctggccgaggctcaggctctggcccgggagatcgcc
gcattcccgcaacggtgcctgcgcgcggatcgcctttccacctatcagcagtgggatcac
gatctgacggaagccctgcgccgtgaaggcgctggcggttacccggtggtattcgccgag
gcgcttgccggggcggcgcgtttcgccaagggcgccgggcgccacggccgcttcgacgat
cacggctag

DBGET integrated database retrieval system