KEGG   Alcanivorax dieselolei: B5T_01426Help
Entry
B5T_01426         CDS       T02259                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase pyridoxal-5'-phosphate-dependent enzyme
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
adi  Alcanivorax dieselolei
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B5T_01426 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B5T_01426 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    B5T_01426 (thrC)
Enzymes [BR:adi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     B5T_01426 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1514166..1515260
Genome map
AA seq 364 aa AA seqDB search
MPFRDRYTGLINRYRDHLPVNDDTPIISLGEGNTPLIRLKNIPRLLGKDVDIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSNAIICASTGNTSAAAAAYAARAGISAFVLIPEGKIAMG
KLAQAMMYGAMIMQIRGNFDQGMELVKQVAEKAPVTIVNSVNPYRLQGQKTAAFEIVEEL
GRAPDYHCLPVGNAGNISAYWMGYSEYHKAGIAGSVPRMVGYQATGAAPFLRGAAVENPE
TVATAIRIGNPQSWDKAWTAQKDSEGWFDELADEEILAAQKLLAQKEGVFCEPASAASIG
GAMRDIKAGKITEGSTIVCTLTGNGLKDPDTAIAQCQQELSSGARMVTIDAELDAVKKAI
LDNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgccattccgtgaccgctacacaggcctgatcaaccgttaccgcgaccacctgccggtg
aacgacgacacgccgatcatcagcctgggcgaaggcaacaccccgctgatccggctcaag
aatattccgcgcctgctcggcaaggacgtggatatctacgtcaagtacgagggcctgaac
cccaccggttccttcaaggatcgcggcatgaccatggcggtgaccaaggcggtggaagag
ggcagcaacgccatcatctgtgcctccaccggcaatacctcggcggcggcggcggcctac
gcggcccgggccggcatctccgcgttcgtattgattccggaaggcaagatcgccatgggc
aagctggcccaggcgatgatgtacggcgccatgatcatgcagatccgcggcaactttgat
cagggcatggaactggtcaagcaagtggcggagaaggcaccggtgaccatcgtcaactcg
gtgaacccgtaccgtctgcagggccagaaaaccgcggctttcgaaatcgtcgaggaactg
ggccgcgccccggactatcactgcctgccagtgggcaacgccggtaatatttccgcctac
tggatgggctacagcgaataccacaaagccggtatcgccggcagcgtaccgcgcatggtc
ggctaccaggccaccggcgcggcgccgttcctgcgtggcgcggcggtggaaaatccggaa
accgtggccaccgccatccgtatcggcaacccgcagtcctgggacaaagcctggaccgcg
cagaaggattccgaaggctggttcgacgaactggccgacgaggaaatcctggccgcgcaa
aaactgctggcgcaaaaagaaggggtgttctgcgaaccggcttccgccgcttccattggt
ggcgccatgcgtgacatcaaggccggcaagatcaccgaaggcagcaccattgtctgcacc
ctgaccggtaacggtctcaaggatccggacaccgccatcgcgcaatgtcagcaggaactg
tcttccggcgcccgcatggtcaccatcgacgccgagctggacgcggtgaagaaagccatt
ctggacaatctgtaa

DBGET integrated database retrieval system