KEGG   Alcanivorax dieselolei: B5T_01495Help
Entry
B5T_01495         CDS       T02259                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
adi  Alcanivorax dieselolei
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:adi01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:adi00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:adi00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1597778..1598977
Genome map
AA seq 399 aa AA seqDB search
MTNDNRGVVYVGDGKVEVRTIGYPKMEDPRGRRIEHGVILKVVSTNICGSDQHMVRGRTT
APEGLVLGHEITGEVIEKGRDVENLALGDLVSVPFNVACGRCRSCQEQHTGVCLNVNPDR
AGGAYGYVDMGGWVGGQSEYALVPYADFNLLRFPDRDRAMEKIRDLTCLSDILPTGFHGA
VSAGVAPGRTVYIAGAGPVGLAAAASARLLGAAVVIVGDVNPRRLQHAKAQGFEIADLSL
DTPLVDQIAALLGEPEVDCAVDAVGFEARGHGREGARSEAPATVLNALMEVTRVAGHIGI
PGLYVTEDPGAVDGAAKLGNLSVRFGLGWAKSHAFHTGQTPVMKYNRQLMQAILWDRINI
AEVVNVQVIDLDQAPEGYGEFDAGVPKKFVLDPHGLVPA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgacaatcgtggcgtggtctacgtgggcgacggcaaggtcgaggtccgcacc
atcggctacccgaaaatggaggaccctcgcggccggcgcattgagcacggcgttattctc
aaggtggtgtccaccaatatctgcggctcggaccagcacatggtgcgtggccgcaccacg
gcgccggaaggcctggtgctggggcacgagatcaccggcgaggtgattgagaaaggccgc
gacgtggagaacctggcgttgggcgacctggtgtccgtgcccttcaacgtggcctgcggg
cgctgccgttcctgccaggagcagcacaccggcgtgtgcctgaacgtgaacccggaccgc
gccggcggcgcctacggctacgtggacatgggcggctgggtgggtggccagtccgagtac
gcgctggtgccctacgccgacttcaatctgctcaggttcccggaccgcgaccgggccatg
gagaagatccgtgatctgacctgcctctccgacattctgcccaccggtttccacggcgcg
gtgagcgccggggtggcgccggggcgtaccgtctacatcgccggcgccggcccggtgggg
ctggccgccgccgcctcggcccggttgctgggcgcggcggtggtgatcgtcggcgacgtc
aacccgcgccgtctgcaacacgccaaggcccagggcttcgagatcgccgacctgtccctg
gatacgcccctggtggatcagatcgccgccctgctgggtgagccggaagtggactgcgcg
gtggacgcggtgggcttcgaggcgcgtggtcacggccgcgagggggcgcgcagcgaagcg
ccggcgacggtgctcaatgccctcatggaggtgacccgggtggccggccacatcggcatt
cccggcctctacgtcaccgaggacccgggtgccgtggacggcgccgccaagctgggcaac
ctgagcgtgcgcttcgggctcggctgggccaagtcccacgccttccataccggccagacc
ccggtgatgaaatacaaccggcaattgatgcaggccatcctctgggaccgcatcaacatc
gccgaggtggtcaacgtccaggtcattgatctggaccaggctccggagggttacggcgag
tttgatgccggcgtgccgaaaaaatttgtgctcgacccccacggcctggtgccggcctga

DBGET integrated database retrieval system