KEGG   Alcanivorax dieselolei: B5T_01746Help
Entry
B5T_01746         CDS       T02259                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
adi  Alcanivorax dieselolei
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B5T_01746 (galU)
   00052 Galactose metabolism
    B5T_01746 (galU)
   00500 Starch and sucrose metabolism
    B5T_01746 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    B5T_01746 (galU)
Enzymes [BR:adi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     B5T_01746 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1869895..1870776
Genome map
AA seq 293 aa AA seqDB search
MISKAVIPVAGLGTRMLPASKSIPKEMLPIVDRPAIHWVVEEAVQAGITEIILVNHAAKG
AIEDYFDINAELDAQLQAKGKESLRQSLRHIIPENVSVISVRQREPLGLGHAVLQAAPVV
GAEPFVVMLPDVLVDAAGGDVDLKAMIRRYQTAGAAQIMVEPVPMDRVNQYGVVSLEGAA
PEAGGSAAMTGVVEKPAPEDAPSNLSVVGRYVLPGAIMELLKTTRPGAGGEIQLTDAIAE
LIGLAPVEAYAMTGKTFDCGNKAGYLEAFIHFALEHPELAGTARSILERHHAR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgatttccaaggctgtgattccggtggcggggttgggcacacgaatgctgcctgcttcc
aaatccattcccaaagagatgttgccgatcgtggatcggccagccattcattgggtggtg
gaagaagccgttcaggcgggcattaccgaaattattctggtcaaccatgcggccaaggga
gccatcgaggattacttcgacatcaatgcggaactggatgcccaactgcaagccaaaggc
aaagagtctttgaggcagagcctgcgtcacattattccggagaatgtgagcgttatcagt
gtgcgccagagggagccgctgggactcggccatgcggtcctgcaagctgctccggtggtg
ggagccgagccgttcgtggtgatgctgccagatgtgctggtggatgcggccggtggcgat
gtggatttaaaagccatgattcgccgctaccagaccgccggcgccgcccagattatggtg
gagccggtgccaatggatcgggtgaatcagtatggcgttgtgtcgctcgaaggcgctgct
cccgaagcgggtgggagcgcggccatgaccggtgtggtggagaagcccgcccctgaagat
gctccttccaacttatccgtggtggggcgttacgtgttgccgggcgcgatcatggaactt
ctgaaaaccacacgtcctggagcgggcggtgaaattcagctaaccgatgccattgccgaa
ctgatagggctggcaccggtggaggcctacgccatgaccggaaagacgtttgattgcggt
aataaggctggttatctggaagcgttcatccacttcgcgcttgaacacccggaattggcc
ggtaccgcccggtccattctggagcggcaccatgcgcgttga

DBGET integrated database retrieval system