KEGG   Alcanivorax dieselolei: B5T_01749Help
Entry
B5T_01749         CDS       T02259                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
adi  Alcanivorax dieselolei
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B5T_01749 (algC)
   00030 Pentose phosphate pathway
    B5T_01749 (algC)
   00051 Fructose and mannose metabolism
    B5T_01749 (algC)
   00052 Galactose metabolism
    B5T_01749 (algC)
   00500 Starch and sucrose metabolism
    B5T_01749 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    B5T_01749 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    B5T_01749 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    B5T_01749 (algC)
Enzymes [BR:adi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     B5T_01749 (algC)
    5.4.2.8  phosphomannomutase
     B5T_01749 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1873699..1875075
Genome map
AA seq 458 aa AA seqDB search
MAAVLSDTLFRAYDIRGIFEDTLTVSAAELIGQAIGSEVIERGGHCVAVARDGRLSSPTL
LDALAKGLQASGCNVVDVGLVPTPVLYFATYHFEDADSGVMITGSHNPPDYNGFKIVIRG
TTLSGDAIQALKARIQQRNFSEGHGTREQREILPAYLAALKARHQLARPMKVVVDCGNGA
AGVLAPEAIASLGCEVIPLYAEVDGTFPNHHPDPGDIETLKDLIDTVRREDADLGLAFDG
DGDRLGVVLPDGKVVYPDVLLMALAEDLVSRVPGAKIIFDVKCTGALFDIIRNAGGEPEM
WRTGHSLIKARMKETGALLAGEMSGHIFFAEDWYGFDDATVAAARILRILSHHDGDAVSF
FDRYPKLCTTPEITIPVTEETKFAIVEYMQKHADLGEGKRTVIDGVRMDYEDGWGLCRAS
NTSPKLVTRYEAVDEMILARIRACFERAIKNAVKMAEI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgttttatccgacactttgttccgagcctacgatattcgcggcatcttcgag
gatacattgacggtatccgccgcggagctgatcggtcaggccatcggttcagaggttatt
gagagagggggacattgtgttgccgtggcgcgcgatggccgtctttcttcccccacttta
ctggatgcccttgccaaggggctgcaagcgagcggctgtaatgtggtggatgtggggctg
gttcccacgccggtactttactttgccacctaccatttcgaggatgcggactccggcgtg
atgattaccggcagccataaccctccggactataatggtttcaaaatcgtcatcagaggc
acgacgctttccggtgacgccattcaggcgctgaaggcccgtatccaacaacggaatttc
tcggaagggcacgggacgcgggagcaacgcgaaattcttcccgcttacctggcggcgctg
aaggcgcgccaccaactggcgcgcccgatgaaggtggtggtggactgcggcaacggtgcc
gcgggggtgttggcaccggaagcgatcgcctcccttggctgcgaagtcataccgctctat
gcggaagtcgacggcactttccccaatcatcatcccgatcccggcgatattgaaaccctc
aaagaccttattgatactgttcgccgggaagacgccgatttgggcctggcctttgacggt
gatggcgaccggttgggagtggtgttgccggatggaaaggtggtttacccggacgtcctg
ttgatggctctggccgaggatctggtcagccgggtgccgggtgccaagatcatctttgac
gtcaaatgtaccggtgctctgtttgatattatccgcaatgcgggcggcgaaccggagatg
tggcgtaccggccactccctgatcaaggcacggatgaaagaaacaggtgcgctgctcgcg
ggtgaaatgagcggccatatcttcttcgccgaagactggtacggctttgacgacgccacc
gttgccgccgcccgtatcctccgtatcctaagccatcatgacggcgacgccgtcagtttc
ttcgatcgctacccgaaactttgcaccaccccggaaatcaccatccccgtcaccgaggaa
accaagttcgccatagtcgaatacatgcagaagcacgccgacctcggcgagggcaaacgc
acggtgatcgatggcgtgcgtatggattatgaggatggctgggggttgtgtcgggcctcc
aatacgtcgcctaagttggtgactcggtatgaggcggtggatgaaatgatattagcccgt
atcagggcctgctttgaaagagccatcaaaaatgccgtcaaaatggctgaaatatag

DBGET integrated database retrieval system