KEGG   Alcanivorax dieselolei: B5T_01892Help
Entry
B5T_01892         CDS       T02259                                 

Definition
short-chain dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
adi  Alcanivorax dieselolei
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:adi00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:adi00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2051993..2052787
Genome map
AA seq 264 aa AA seqDB search
MGEQAGRLHGKVALITGAARGIGRGIAECYAREGARVAVADLDSDSAGETAAAIRATGGE
AMAVTMDVTDEAAVSDGVSAVVTAWGGLDVAFANAGIQHIDPLDQLSFANWRKVMAVHLD
GAFLLTREALRAMYASGGGTMLYMGSVHSLEASPLKAPYVAAKHALLGLCRSVAKEGAAH
GVRSNIICPGFVRTPLVDKQIPEQAKELGISEDEVIRNVMLKNTVDGEFTTVEDVAELAL
HLAAFPSAALTGQSVVVSHGWHMG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggagagcaagcgggacgtctgcacggcaaggtggcgttgatcaccggcgccgctcgc
ggcattggccggggcatcgccgagtgctatgcccgggaaggggcgcgggtggcggtggcc
gacctggacagtgacagtgccggggaaacggcggcggcgattcgggccaccggcggcgag
gccatggcggtgaccatggatgttaccgacgaagcggcggtcagcgacggcgtcagcgcc
gtggtgaccgcctggggcggtctggacgtggcgttcgccaatgccggcattcaacacatc
gacccgctggatcagttgtccttcgccaattggcgcaaggtcatggcggtgcatctggat
ggcgcttttctgcttacccgggaggcgctgcgggccatgtatgccagcggtggcggcacc
atgctgtacatggggtcggtgcattcactggaagcctcaccgctgaaagcgccctatgtg
gccgccaagcacgccctgcttggcctgtgccgttcggtggcgaaggagggtgccgcccac
ggtgtgcgcagcaacatcatctgtcccggcttcgtgcgcaccccactggtggataaacag
atcccggagcaggcaaaagagctcggcatctccgaggatgaagtgatccgcaacgtcatg
ctcaagaacaccgtggacggcgaattcaccaccgtggaggatgtggcggaactggccctg
cacctggcggccttcccctcggcggcgctcaccggccagtccgtggtggtcagccatggg
tggcatatgggatag

DBGET integrated database retrieval system