KEGG   Alcanivorax dieselolei: B5T_01892Help
Entry
B5T_01892         CDS       T02259                                 

Definition
short-chain dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
adi  Alcanivorax dieselolei
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    B5T_01892
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    B5T_01892
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     B5T_01892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2051993..2052787
Genome map
AA seq 264 aa AA seqDB search
MGEQAGRLHGKVALITGAARGIGRGIAECYAREGARVAVADLDSDSAGETAAAIRATGGE
AMAVTMDVTDEAAVSDGVSAVVTAWGGLDVAFANAGIQHIDPLDQLSFANWRKVMAVHLD
GAFLLTREALRAMYASGGGTMLYMGSVHSLEASPLKAPYVAAKHALLGLCRSVAKEGAAH
GVRSNIICPGFVRTPLVDKQIPEQAKELGISEDEVIRNVMLKNTVDGEFTTVEDVAELAL
HLAAFPSAALTGQSVVVSHGWHMG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggagagcaagcgggacgtctgcacggcaaggtggcgttgatcaccggcgccgctcgc
ggcattggccggggcatcgccgagtgctatgcccgggaaggggcgcgggtggcggtggcc
gacctggacagtgacagtgccggggaaacggcggcggcgattcgggccaccggcggcgag
gccatggcggtgaccatggatgttaccgacgaagcggcggtcagcgacggcgtcagcgcc
gtggtgaccgcctggggcggtctggacgtggcgttcgccaatgccggcattcaacacatc
gacccgctggatcagttgtccttcgccaattggcgcaaggtcatggcggtgcatctggat
ggcgcttttctgcttacccgggaggcgctgcgggccatgtatgccagcggtggcggcacc
atgctgtacatggggtcggtgcattcactggaagcctcaccgctgaaagcgccctatgtg
gccgccaagcacgccctgcttggcctgtgccgttcggtggcgaaggagggtgccgcccac
ggtgtgcgcagcaacatcatctgtcccggcttcgtgcgcaccccactggtggataaacag
atcccggagcaggcaaaagagctcggcatctccgaggatgaagtgatccgcaacgtcatg
ctcaagaacaccgtggacggcgaattcaccaccgtggaggatgtggcggaactggccctg
cacctggcggccttcccctcggcggcgctcaccggccagtccgtggtggtcagccatggg
tggcatatgggatag

DBGET integrated database retrieval system