KEGG   Alcanivorax dieselolei: B5T_01927Help
Entry
B5T_01927         CDS       T02259                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
adi  Alcanivorax dieselolei
Pathway
adi00900  Terpenoid backbone biosynthesis
adi01100  Metabolic pathways
adi01110  Biosynthesis of secondary metabolites
adi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B5T_01927 (dxr)
Enzymes [BR:adi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     B5T_01927 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh Epimerase
Motif
Other DBs
NCBI-ProteinID: AFT70202
UniProt: K0CEV2
Position
2090514..2091686
Genome map
AA seq 390 aa AA seqDB search
MKERITVLGATGSIGCQTLEVLALHPERYEVVALTAGHRWRELAEQCLRWRPRYAALADE
QAAGELRNHLKAAGSDTEVLAGHQGVCAVAGLDDVDTVVAAIVGAAGVRPTLAAVGAGKK
ILLANKETLVVTGALFMEAVKRHGATLLPVDSEHNAIFQCLPRGGVDQGVRRVLLTASGG
PFLGWSAEQLASVTPEQAVRHPNWDMGPKISVDSATLMNKGLEFIEACWLFDMPPERVDV
VIHPQSVVHSMVEYLDGSVLAQMGTPDMRTPIACALAWPQRIASGAPSLDFAKLAELRFL
PPDEKAFPCLALARQAMQAGGAATAVLNAANEVAVAAFLDGGLGFQHIGSVVANTLDALP
GGCCDDVDEVMDLDGRARELARQQLVTLGR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggagcgtattaccgtcctcggtgccaccggcagcatcggctgccagaccctggag
gtgctggccctgcacccggaacgctatgaagtggtggcgctgacggcgggccatcgctgg
cgtgaactggcggaacagtgtctgcgctggcgcccgcgttacgccgctctggcggacgaa
caggccgccggcgagcttcggaaccatctcaaggcggcagggtctgacaccgaagtgctg
gccgggcaccagggtgtgtgcgctgtcgccgggctggacgatgtggacacggtggtcgcc
gccatcgtcggcgccgctggcgtgcgtccgaccctggcggcggtcggcgccggcaagaaa
attctgctggcgaacaaggaaaccctggtggtgaccggcgcgctgttcatggaggcggtg
aagcgccacggtgccacgctgttgccggtggattccgagcataatgccatcttccagtgt
ctgccccggggcggcgtggaccagggcgtgcgaagagtgctgctgaccgcctccggcggt
ccgtttctgggctggtccgctgagcaactggcgtcggtgacgccggagcaggcagtgcgg
catcccaactgggacatggggccgaagatttccgtggattccgccacgctgatgaacaaa
ggcctggaattcattgaggcctgctggttgttcgatatgccgcccgaacgggtggacgtg
gtgattcacccgcaaagcgtggtgcattccatggtcgaatacctggacggctcggtgctg
gcgcaaatgggcacaccggatatgcgcacgccgatcgcctgcgcgctggcgtggccacag
cggatcgcctccggcgcgccgtcactggatttcgccaagcttgccgagctgcgtttcctg
ccgccggatgagaaagcctttccctgcctggctctggcccggcaggcgatgcaggcgggc
ggcgccgccaccgccgtgctcaacgccgccaatgaagtggcggtggccgcttttcttgac
ggcgggctgggtttccagcatatcggtagcgtagtggcgaacactctggacgccttgccc
ggcggttgctgtgacgatgtggatgaagtgatggacctggacggccgcgcgcgggaactg
gcccggcaacaattagtgacgttgggccgatga

DBGET integrated database retrieval system