KEGG   Alcanivorax dieselolei: B5T_01948Help
Entry
B5T_01948         CDS       T02259                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase 1
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
adi  Alcanivorax dieselolei
Brite
Enzymes [BR:adi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     B5T_01948 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2113162..2113794
Genome map
AA seq 210 aa AA seqDB search
MTSARTRERLISRLRESGITDERVLEAIRATPRHLFVDEALSHQAYDDTALPIGHGQTIS
QPWVVARMTELLIEQAIPEKVLEVGTGCGYQTAVLAAFARQVCSVERIRPLQDAARLRLR
ELGLANRVQLRHADGGFGWSSAAPFDGILVTCARPDIPEELLAQLAEGGRLVMPVGDRQQ
RLTVVDRHGNELVSRALDPVRFVPFQRGVQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccgcgcgtacccgggaacggctgatcagccggctaagggaatcggggatcacc
gatgaacgggtactggaagccattcgcgccacgccacggcatttgttcgtggacgaggcg
ctgtcccatcaggcctatgacgataccgccctgccgatcggccacgggcagaccatttcc
cagccctgggtggtggcgcgcatgaccgagctgctgatcgagcaggcgattccggagaag
gtgctggaggtgggaaccggctgcggttaccagaccgcggtactggccgctttcgcccgt
caggtctgttcggtggagcggatccgccctttgcaggatgccgcccggctgcggctgcgt
gagctgggactggccaaccgggtgcagctgcgccatgccgacggcggcttcggctggtcc
tcggcggccccgttcgatggcatcctggtgacctgcgcccgtccggacatccccgaggaa
ctgcttgcccaactggccgagggaggccgtctggtgatgccggtgggggatcgccaacaa
cggctgaccgtggtggatcggcatggcaacgaactggtgtcgcgggcgctggacccggtg
cgcttcgtgccctttcagagaggcgtgcaatga

DBGET integrated database retrieval system