KEGG   Alcanivorax dieselolei: B5T_01960Help
Entry
B5T_01960         CDS       T02259                                 

Gene name
glcB
Definition
(RefSeq) Malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
adi  Alcanivorax dieselolei
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B5T_01960 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B5T_01960 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    B5T_01960 (glcB)
Enzymes [BR:adi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     B5T_01960 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126514..2128688
Genome map
AA seq 724 aa AA seqDB search
MTDRIKKGGLEIAAELHDLVVNEVAPGTGVDVEHFWAQLEQIVADLAPRNKALLAKRDEI
QQKIDGWHLERKGKQIDLPEYKRFLTELGYLLPEGDDFKVATRNVDNEIAHIAGPQLVVP
VKNARFALNAANARWGSLYDALYGTDVISEEDGAVRGGGYNPKRGDKVIAFARDFLDTYF
PLASGSHKDSTGYAIRDGKLVVSLKEGESGLADEGQLRGFLGDAERPSGVLLKHNNLHAE
IQIDDQHPIGAEDPANVKDVLLESAITTIQDCEDSVAAVDAEDKVEVYRNWAGLMKGDLK
ESFDKGGRTLSRALNPDREYTALDGGKLVLPGRSLLLVRNVGHLMTNPAILHNGEEIPEG
IMDAMVTVLAAIHDLKKQDGADFRNSRTGSVYIVKPKMHGPEEVAFAVELFERVEKALGL
PANTLKIGIMDEERRTTVNLKECIRQAKDRVIFINTGFLDRTGDEMHTSMEAGPMARKGD
MKGMPWINAYENWNVDIGLECGLQGVAQIGKGMWAKPDEMAEMMATKAGHPKAGANCAWV
PSPTAATLHVMHYHEVNVQQVQDQLASRGRASLDDILTIPLLEGELTANEIQQELDNNAQ
GILGYVVRWIDQGVGCSKVPDINNVGLMEDRATCRISSQHIANWLHHGIVTEEQVMESMK
RMAQVVDKQNAGDPTYMDMAPNFDDSIAFQASCDLVFKGCEQPSGYTEPVLHRRRRELKA
KLAG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcattaaaaagggcggactggaaatcgccgctgaacttcatgatctggta
gtcaacgaagtggcgccgggtaccggtgtggatgtggaacacttctgggcgcagctggaa
cagatcgtggccgacctggcgccgcgcaacaaggctctgctggccaagcgtgacgagatc
cagcagaagatcgacggctggcacctggagcgcaagggcaagcagatcgacctgccggaa
tacaagcgcttcctcaccgagctgggctacttgctgccggaaggcgatgatttcaaagtg
gccacccggaacgtggacaacgagatcgcccacatcgccggtccgcagttggtggtgccg
gtgaagaacgcccgtttcgccctgaacgccgccaacgcccgctggggcagcctgtatgac
gcgctctacggtaccgacgtcatctccgaggaagacggcgccgtgcgcggcggcggctac
aacccgaaacgcggcgacaaggtgattgcctttgcccgtgatttcctcgacacctatttc
ccgctggccagcggctcccacaaggacagcaccggctacgcgatccgcgacggcaagctg
gtggtgagcctgaaagagggcgaatccggactggccgacgaaggccagctgcgcggcttc
ctgggcgacgccgagcggcccagcggcgtgctgctcaagcacaacaacctgcacgcggaa
atccagatcgacgatcagcatccgatcggcgccgaggacccggccaacgtcaaggacgtg
ctgctggaatccgccatcaccaccatccaggactgcgaagactccgtcgccgcggtggac
gccgaggacaaagtcgaggtgtaccgcaactgggcgggcctgatgaaaggcgacctgaag
gaaagcttcgacaagggcggccgcaccctgagccgcgccctcaacccggaccgtgaatac
accgcgctggacggcggcaagctggtgctgccgggccgttccctgctgctggtgcgcaac
gtcggtcacctgatgaccaacccggcgatcctgcacaacggtgaggaaatcccggaaggc
atcatggacgccatggtcaccgtgctggccgccatccacgatctgaagaagcaggacggc
gccgatttccgcaacagccgcaccggctccgtgtacatcgtgaagccgaaaatgcacggt
ccggaagaagtggcgttcgcggtggaactgttcgagcgcgtggaaaaagcgctgggcctg
ccggccaacaccctgaagatcggcatcatggacgaagagcgccgtaccaccgtgaacctg
aaggaatgtatccgtcaggccaaggaccgggtgatcttcatcaacaccggtttcctcgac
cgtaccggtgacgagatgcacacctccatggaagcgggcccgatggcgcgcaaaggcgat
atgaaaggcatgccctggatcaacgcctatgaaaactggaacgtggatatcggcctggaa
tgcggcctgcaaggcgtggcccagatcggtaaaggcatgtgggcgaagccggacgaaatg
gcggaaatgatggccaccaaggccggtcacccgaaagccggcgccaactgcgcctgggtg
ccgtcacccaccgccgccaccctgcacgtgatgcactatcacgaagtgaacgtgcagcag
gtacaggatcaactggccagccgcggtcgcgcctccctggacgacatcctcaccattccg
ttgctggaaggcgaactgaccgccaatgaaatccagcaggaactggacaacaacgcccag
ggtatcctcggctacgtggtgcgctggatcgaccagggcgtgggctgttccaaggtgccg
gacatcaacaacgtgggcctgatggaagaccgcgccacctgccgtatctccagccagcac
atcgccaactggctgcaccatggcattgtcaccgaggaacaggtgatggagtccatgaag
cgcatggcgcaggtggtggacaagcagaacgccggtgacccgacctacatggacatggcg
ccgaacttcgatgacagcatcgccttccaggcgtcctgtgatctggtgttcaagggctgc
gagcagcccagcggctacaccgagccggtcctgcaccgccgtcgccgtgaactgaaagcc
aaactggccggttaa

DBGET integrated database retrieval system