KEGG   Alcanivorax dieselolei: B5T_01960Help
Entry
B5T_01960         CDS       T02259                                 

Gene name
glcB
Definition
Malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
adi  Alcanivorax dieselolei
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:adi01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:adi00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:adi00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2126514..2128688
Genome map
AA seq 724 aa AA seqDB search
MTDRIKKGGLEIAAELHDLVVNEVAPGTGVDVEHFWAQLEQIVADLAPRNKALLAKRDEI
QQKIDGWHLERKGKQIDLPEYKRFLTELGYLLPEGDDFKVATRNVDNEIAHIAGPQLVVP
VKNARFALNAANARWGSLYDALYGTDVISEEDGAVRGGGYNPKRGDKVIAFARDFLDTYF
PLASGSHKDSTGYAIRDGKLVVSLKEGESGLADEGQLRGFLGDAERPSGVLLKHNNLHAE
IQIDDQHPIGAEDPANVKDVLLESAITTIQDCEDSVAAVDAEDKVEVYRNWAGLMKGDLK
ESFDKGGRTLSRALNPDREYTALDGGKLVLPGRSLLLVRNVGHLMTNPAILHNGEEIPEG
IMDAMVTVLAAIHDLKKQDGADFRNSRTGSVYIVKPKMHGPEEVAFAVELFERVEKALGL
PANTLKIGIMDEERRTTVNLKECIRQAKDRVIFINTGFLDRTGDEMHTSMEAGPMARKGD
MKGMPWINAYENWNVDIGLECGLQGVAQIGKGMWAKPDEMAEMMATKAGHPKAGANCAWV
PSPTAATLHVMHYHEVNVQQVQDQLASRGRASLDDILTIPLLEGELTANEIQQELDNNAQ
GILGYVVRWIDQGVGCSKVPDINNVGLMEDRATCRISSQHIANWLHHGIVTEEQVMESMK
RMAQVVDKQNAGDPTYMDMAPNFDDSIAFQASCDLVFKGCEQPSGYTEPVLHRRRRELKA
KLAG
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcattaaaaagggcggactggaaatcgccgctgaacttcatgatctggta
gtcaacgaagtggcgccgggtaccggtgtggatgtggaacacttctgggcgcagctggaa
cagatcgtggccgacctggcgccgcgcaacaaggctctgctggccaagcgtgacgagatc
cagcagaagatcgacggctggcacctggagcgcaagggcaagcagatcgacctgccggaa
tacaagcgcttcctcaccgagctgggctacttgctgccggaaggcgatgatttcaaagtg
gccacccggaacgtggacaacgagatcgcccacatcgccggtccgcagttggtggtgccg
gtgaagaacgcccgtttcgccctgaacgccgccaacgcccgctggggcagcctgtatgac
gcgctctacggtaccgacgtcatctccgaggaagacggcgccgtgcgcggcggcggctac
aacccgaaacgcggcgacaaggtgattgcctttgcccgtgatttcctcgacacctatttc
ccgctggccagcggctcccacaaggacagcaccggctacgcgatccgcgacggcaagctg
gtggtgagcctgaaagagggcgaatccggactggccgacgaaggccagctgcgcggcttc
ctgggcgacgccgagcggcccagcggcgtgctgctcaagcacaacaacctgcacgcggaa
atccagatcgacgatcagcatccgatcggcgccgaggacccggccaacgtcaaggacgtg
ctgctggaatccgccatcaccaccatccaggactgcgaagactccgtcgccgcggtggac
gccgaggacaaagtcgaggtgtaccgcaactgggcgggcctgatgaaaggcgacctgaag
gaaagcttcgacaagggcggccgcaccctgagccgcgccctcaacccggaccgtgaatac
accgcgctggacggcggcaagctggtgctgccgggccgttccctgctgctggtgcgcaac
gtcggtcacctgatgaccaacccggcgatcctgcacaacggtgaggaaatcccggaaggc
atcatggacgccatggtcaccgtgctggccgccatccacgatctgaagaagcaggacggc
gccgatttccgcaacagccgcaccggctccgtgtacatcgtgaagccgaaaatgcacggt
ccggaagaagtggcgttcgcggtggaactgttcgagcgcgtggaaaaagcgctgggcctg
ccggccaacaccctgaagatcggcatcatggacgaagagcgccgtaccaccgtgaacctg
aaggaatgtatccgtcaggccaaggaccgggtgatcttcatcaacaccggtttcctcgac
cgtaccggtgacgagatgcacacctccatggaagcgggcccgatggcgcgcaaaggcgat
atgaaaggcatgccctggatcaacgcctatgaaaactggaacgtggatatcggcctggaa
tgcggcctgcaaggcgtggcccagatcggtaaaggcatgtgggcgaagccggacgaaatg
gcggaaatgatggccaccaaggccggtcacccgaaagccggcgccaactgcgcctgggtg
ccgtcacccaccgccgccaccctgcacgtgatgcactatcacgaagtgaacgtgcagcag
gtacaggatcaactggccagccgcggtcgcgcctccctggacgacatcctcaccattccg
ttgctggaaggcgaactgaccgccaatgaaatccagcaggaactggacaacaacgcccag
ggtatcctcggctacgtggtgcgctggatcgaccagggcgtgggctgttccaaggtgccg
gacatcaacaacgtgggcctgatggaagaccgcgccacctgccgtatctccagccagcac
atcgccaactggctgcaccatggcattgtcaccgaggaacaggtgatggagtccatgaag
cgcatggcgcaggtggtggacaagcagaacgccggtgacccgacctacatggacatggcg
ccgaacttcgatgacagcatcgccttccaggcgtcctgtgatctggtgttcaagggctgc
gagcagcccagcggctacaccgagccggtcctgcaccgccgtcgccgtgaactgaaagcc
aaactggccggttaa

DBGET integrated database retrieval system