KEGG   Alcanivorax dieselolei: B5T_01973Help
Entry
B5T_01973         CDS       T02259                                 

Gene name
trpB-1
Definition
(GenBank) Tryptophan synthase, beta chain-like protein
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
adi  Alcanivorax dieselolei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:adi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    B5T_01973 (trpB-1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B5T_01973 (trpB-1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B5T_01973 (trpB-1)
Enzymes [BR:adi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     B5T_01973 (trpB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2142201..2143562)
Genome map
AA seq 453 aa AA seqDB search
MSDTTQYFLEQSRLPRQWYNIMADFPEPMAPVLHPGTRQPVAPSDLAPLFPDTLIAQEMT
AERYVEIPAAVLDIYKMWRPSPLIRARRLEKALDTPARIYFKYEGVSPAGSHKPNTAVAQ
AYYNAEAGTRRLTTETGAGQWGSSLAFAGSLFGLEVQVFQVKVSYQQKPYRQALMRTYGA
ECIPSPSNLTNAGRAILAENPDHPGSLGIAISEAVELAAQADDTKYALGSVLNHVMLHQS
IIGQEALLQMEMAGDDPDILIGCTGGGSNFAGLVFPFLGEQLRGGRSRRILAVEPAACPT
LTQGRFAYDFGDTAHLTPLTKMHTLGSSFTPPGFHAGGLRYHGMGPQVSHALQLGLIEAR
AYAQTGCFEAAVQFARHEGIVPAPECSHAVKAAIDEALRCKEEGQGQTILFNLSGHGHFD
MQAYIDFFDGKLEDREYDAAAAEVALAQLPQLG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaccacccagtatttcctggagcaatcccgtctgccacgccagtggtacaac
atcatggcggacttcccggaaccgatggccccggtgctgcatcccggcacccgtcagccg
gtggccccttcggatctggcgcccttgttcccggataccctgatcgcccaggaaatgacc
gccgaacgctatgtggagattccggcagcggtgctggacatctacaagatgtggcggcca
agtccgctgatccgtgcccggcggctggaaaaagccctggatacgccggcgcgcatctac
ttcaaatacgagggcgtgagccccgccggctcgcacaagccgaacaccgccgtggcccag
gcctattacaatgcggaagccggcacccgccgtctgaccaccgaaaccggcgccggccag
tggggctcttccctggcgttcgccggcagcctgttcggtctcgaggtgcaggtattccag
gtcaaggtgtcctatcaacaaaagccctatcggcaggcactgatgcgcacctacggggcc
gagtgcatcccctccccgtccaatctcaccaacgccggccgcgccatactggcggagaac
cccgatcacccgggcagcctcggcatcgccatcagcgaggcggtggaactggcggcccag
gccgatgataccaagtacgcccttggttccgtgctcaaccatgtgatgctgcatcaaagc
atcatcggccaggaagccctgctgcagatggaaatggccggcgacgatccggatatactg
atcggctgcaccggcggcggctccaacttcgccggcctggtgtttccgttcctcggcgag
caactgcgtggtggccgcagccgccgcatcctggcggtggagccggcggcctgcccgacc
ctgactcagggccggttcgcctacgacttcggcgacaccgcccacctgacaccgctgacc
aagatgcacaccctgggctccagcttcaccccgccgggcttccacgccggcggcctgcgt
taccatggcatgggcccgcaggtttcccacgcgttgcaactggggctgatcgaagcccgc
gcgtacgcccagaccggctgcttcgaggcggcggtgcaattcgcccgccacgaaggcatc
gtgccggcaccagagtgctcccacgcggtcaaggccgccatcgacgaagctctgcgctgc
aaggaagaaggccagggacaaaccatcctgttcaacctgtccggccacggtcatttcgac
atgcaggcctacatcgatttcttcgatggcaaactggaagaccgtgagtacgacgccgcc
gccgcggaagtggcgctggcgcagttgcctcagctcggttga

DBGET integrated database retrieval system