KEGG   Alcanivorax dieselolei: B5T_01973Help
Entry
B5T_01973         CDS       T02259                                 

Gene name
trpB-1
Definition
tryptophan synthase subunit beta-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
adi  Alcanivorax dieselolei
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:adi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:adi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:adi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2142201..2143562)
Genome map
AA seq 453 aa AA seqDB search
MSDTTQYFLEQSRLPRQWYNIMADFPEPMAPVLHPGTRQPVAPSDLAPLFPDTLIAQEMT
AERYVEIPAAVLDIYKMWRPSPLIRARRLEKALDTPARIYFKYEGVSPAGSHKPNTAVAQ
AYYNAEAGTRRLTTETGAGQWGSSLAFAGSLFGLEVQVFQVKVSYQQKPYRQALMRTYGA
ECIPSPSNLTNAGRAILAENPDHPGSLGIAISEAVELAAQADDTKYALGSVLNHVMLHQS
IIGQEALLQMEMAGDDPDILIGCTGGGSNFAGLVFPFLGEQLRGGRSRRILAVEPAACPT
LTQGRFAYDFGDTAHLTPLTKMHTLGSSFTPPGFHAGGLRYHGMGPQVSHALQLGLIEAR
AYAQTGCFEAAVQFARHEGIVPAPECSHAVKAAIDEALRCKEEGQGQTILFNLSGHGHFD
MQAYIDFFDGKLEDREYDAAAAEVALAQLPQLG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaccacccagtatttcctggagcaatcccgtctgccacgccagtggtacaac
atcatggcggacttcccggaaccgatggccccggtgctgcatcccggcacccgtcagccg
gtggccccttcggatctggcgcccttgttcccggataccctgatcgcccaggaaatgacc
gccgaacgctatgtggagattccggcagcggtgctggacatctacaagatgtggcggcca
agtccgctgatccgtgcccggcggctggaaaaagccctggatacgccggcgcgcatctac
ttcaaatacgagggcgtgagccccgccggctcgcacaagccgaacaccgccgtggcccag
gcctattacaatgcggaagccggcacccgccgtctgaccaccgaaaccggcgccggccag
tggggctcttccctggcgttcgccggcagcctgttcggtctcgaggtgcaggtattccag
gtcaaggtgtcctatcaacaaaagccctatcggcaggcactgatgcgcacctacggggcc
gagtgcatcccctccccgtccaatctcaccaacgccggccgcgccatactggcggagaac
cccgatcacccgggcagcctcggcatcgccatcagcgaggcggtggaactggcggcccag
gccgatgataccaagtacgcccttggttccgtgctcaaccatgtgatgctgcatcaaagc
atcatcggccaggaagccctgctgcagatggaaatggccggcgacgatccggatatactg
atcggctgcaccggcggcggctccaacttcgccggcctggtgtttccgttcctcggcgag
caactgcgtggtggccgcagccgccgcatcctggcggtggagccggcggcctgcccgacc
ctgactcagggccggttcgcctacgacttcggcgacaccgcccacctgacaccgctgacc
aagatgcacaccctgggctccagcttcaccccgccgggcttccacgccggcggcctgcgt
taccatggcatgggcccgcaggtttcccacgcgttgcaactggggctgatcgaagcccgc
gcgtacgcccagaccggctgcttcgaggcggcggtgcaattcgcccgccacgaaggcatc
gtgccggcaccagagtgctcccacgcggtcaaggccgccatcgacgaagctctgcgctgc
aaggaagaaggccagggacaaaccatcctgttcaacctgtccggccacggtcatttcgac
atgcaggcctacatcgatttcttcgatggcaaactggaagaccgtgagtacgacgccgcc
gccgcggaagtggcgctggcgcagttgcctcagctcggttga

DBGET integrated database retrieval system